PRGDB00063937 (Zm.5593)

From PRG Wiki
Jump to: navigation, search
Zm.5593
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195647839 (EU971270)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 360947 mRNA sequence

DNA Sequence

ACCAGTCAGCACTCAGCACACAGAGTCCGCCTCCGCCGCGGCTCCGGCGCCCGCATCCGTCTCAGGAGTCCCTTCTCCCCGCGGGTGGAGACATCTTGATCATTTCTGAGATTAAACTGATGATGCTGATGCTCGTTTAGTTATCTTGGTTTGGAGATATATCAGATATGGGTGATCGGAATCATGGACGCTCTCTCCCTCTACTGCTCTATCTACATCTTTTGCTGCCAATACTTCCGTTTGCTATGGCAGATATAGCCTCCGAGAAGCAAGCACTCCTTGCTTTTGCCTCTGCAGTCTACCATGGCAACAAACTGAATTGGAGCCAAAATATCCCAGTGTGCTCATGGCATGGTGTGACATGCTCACTGGATCGATCGTGTATATTGGCCCTTAGGGTGCCAGGTGCTGGTTTGATTGGTACCATTCCTGCTGATACTCTTGGCAGGCTTGTGTCCCTCCAAGTTTTAAGCATGAGGTCTAACCGTTTGAGTGGAAGCCTTCCGAACGATGTTGTCTCACTTCCTTCTTTACAAGCCATATTTGTTCAGCACAACGAACTGTCAGGAGACTTGCCTCCATTTCTCTCTCCAAACCTTAATACCCTTGATCTCTCTTACAACTCCTTTACAGGACAAATCCCATCAGGTTTGCAGAATCTTACCAAATTGTCTGTCTTGAATTTAGCAGAAAATTCCCTGTCCGGGCCGATTCCGGATCTCAAACTTCCTAGCTTAAGACAGCTAAATCTGAGCAACAATGAACTGAATGGTTCGATTCCTCCCTTTTTCCAAATCTTCTCAAATAGTTCCTTCCTAGGGAACTCTGGATTGTGTGGACCGCCGCTAACTGAATGTTCTTTTCTATCTTCACCAACACCGTCGCAAGTGCCTTCACCACCAAAATTACCAAATCATGAGAAGAAGGCTGGCAATGGCTTGGTAATCGTGGCTGTTGCTGGGAGCTTTGTCATATTTCTGCTAGCTGCTGTGATGTTCACTATGTGCATTTCAAAGAGGAAGGAGAAGAAAGACGAAGCGGGTTACAACGGTAAGGTTACTGATGGTGGAAGGATTGAGAAGCGCAAAGAGGATCTCAGCAGTGGCGTCCAAATGGCGCATAAGAACAAGTTAGTTTTCTTGGAGGGATGCAGTTACAACTTTGACTTGGAGGACTTGCTGAGAGCTTCTGCTGAAGTTCTCGGGAAAGGGAGCTATGGAACTGCCTACAAGGCTATACTCGAGGATGGCTCTACTGTGGTAGTCAAGAGGCTAAAGGATGTCGTGGCAGGGAAGAAAGAATTTGAGCAGCAGATGGAGCTCATAGGGAGGGTAGGTAAACATGCAAACATCGCGCCCTATTCGTGCTTACTACTACTCGAAGGATGAGAAGCTTGTTGTTTATGAGTATATTGGTAGAGGCAGCTTCTCAGCTCTGTTGCATGGTATCAAGGGCGTGTGTGAGAAGACCCCATTAGATTGGAACACAAGGATGAAGATTATACTCGGAACAGCACGCGGCCTCGAGCACATCCATTCAGAAGGCGGCTCCAGGCTCGCACACGGCAACATCAAGTCAACCAACGTTCTGCTCGACGGAGACCACAACCCTTACGTCTCAGACTACGGGCTGAGCTCGTTGACGAGCCTTCCGATCACCACTTCCCGAGCTGTCGCTGGCTACCGAGCTCAGGAGACCTTCGAATCGAGGAAGTTCACCCACAAGTCCGACGTGTACGGTTTCGGCGTCCTCCTCATGGAGACGCTGACGGGCAAGGCCCCGCTTCAGTCACAGGGTCAGGACGACGCCGTCGACCTACCGAGGTGGGTGCATTCGGTGGTCCGCGAGGAGTGGACCGCTGAGGTGTTTGACGTCCAGCTGATGAAGTATCCCAACATAGAAGACGAGCTGGTCCAGATGCTCCGTATCGCCATGGCGTGCACGGCGTGGTCTCCCGACCGGCGTCCGACGATGGCGCAGGTGGTTAGGATGGTGGAGGAGCTCCGGCACTCTGCTTCCGGGAGTCGCGCTCTCTCCGTTGGCAGTCCCAAGGAATCCAGCCCTCTGTCAGCCTGAATTGTGGTTCTGATTCAGAATTCGTGTATCCATGACATCGATGATCGATGGTATCCTGCATGTGGTTCACGGTGCACACGTTGTCTGCCTCGTCAGATACTTCGTACTGCTGTAACTTTGGTTCAATGGAATGCTTAAGAAACAAGGTCGGAATAGGCGAATAGCTATTTTCGTCTTTCaaaaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.5593 translated coding region predicted by ESTScan from UniGene Zm.5593

XQSALSTQSPPPPRLRRPHPSQESLLPAGGDILIISEIKLMMLMLVXLSWFGDISDMGDRNHGRSLPLLLYLHLLLPILPFAMADIASEKQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCSLDRSCILALRVPGAGLIGTIPADTLGRLVSLQVLSMRSNRLSGSLPNDVVSLPSLQAIFVQHNELSGDLPPFLSPNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNELNGSIPPFFQIFSNSSFLGNSGLCGPPLTECSFLSSPTPSQVPSPPKLPNHEKKAGNGLVIVAVAGSFVIFLLAAVMFTMCISKRKEKKDEAGYNGKVTDGGRIEKRKEDLSSGVQMAHKNKLVFLEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSASGSRALSVGSPKESSPLSAXIVVLIQNSCIHDIDDRWYPACGSRCTRCLPRQILRTAVTLVQWNA

Domains

Domain Start-End Description Sequence

Seg: seg
10-20 seg

PPPPRLRRPHP

HMMPanther: PTHR24420
48-730 FAMILY NOT NAMED,FAMILY NOT NAMED

LSWFGDISDMGDRNHGRSLPLLLYLHLLLPILPFAMADIASEKQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCSLDRSCILALRVPGAGLIGTIPADTLGRLVSLQVLSMRSNRLSGSLPNDVVSLPSLQAIFVQHNELSGDLPPFLSPNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNELNGSIPPFFQIFSNSSFLGNSGLCGPPLTECSFLSSPTPSQVPSPPKLPNHEKKAGNGLVIVAVAGSFVIFLLAAVMFTMCISKRKEKKDEAGYNGKVTDGGRIEKRKEDLSSGVQMAHKNKLVFLEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSASGSRALSVGSPKESSPLSAXIVVLIQNSCIHDIDDRWYPACGSRCTRCLPRQILRTAV

HMMPanther: PTHR24420:SF547
48-730 SUBFAMILY NOT NAMED

LSWFGDISDMGDRNHGRSLPLLLYLHLLLPILPFAMADIASEKQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCSLDRSCILALRVPGAGLIGTIPADTLGRLVSLQVLSMRSNRLSGSLPNDVVSLPSLQAIFVQHNELSGDLPPFLSPNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNELNGSIPPFFQIFSNSSFLGNSGLCGPPLTECSFLSSPTPSQVPSPPKLPNHEKKAGNGLVIVAVAGSFVIFLLAAVMFTMCISKRKEKKDEAGYNGKVTDGGRIEKRKEDLSSGVQMAHKNKLVFLEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSASGSRALSVGSPKESSPLSAXIVVLIQNSCIHDIDDRWYPACGSRCTRCLPRQILRTAV

Seg: seg
66-80 seg

LPLLLYLHLLLPILP

superfamily: SSF52058
80-287 L domain-like,LRR

PFAMADIASEKQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCSLDRSCILALRVPGAGLIGTIPADTLGRLVSLQVLSMRSNRLSGSLPNDVVSLPSLQAIFVQHNELSGDLPPFLSPNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNELNGSIPPFFQIFSNSSFLGNSGLCGPPLTECS

HMMPfam: PF08263
IPR013210
87-123 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ASEKQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCS

Gene3D: G3DSA:3.80.10.10
90-269 no description

KQALLAFASAVYHGNKLNWSQNIPVCSWHGVTCSLDRSCILALRVPGAGLIGTIPADTLGRLVSLQVLSMRSNRLSGSLPNDVVSLPSLQAIFVQHNELSGDLPPFLSPNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNELNGSIPPFFQIFSN

HMMPfam: PF00560
IPR001611
153-171 LRR_1
Leucine-rich repeat

SLQVLSMRSNRLSGSLPND

HMMPfam: PF13855
198-256 LRR_8,Leucine rich repeat

PNLNTLDLSYNSFTGQIPSGLQNLTKLSVLNLAENSLSGPIPDLKLPSLRQLNLSNNEL

FPrintScan: PR00019
200-213 LEURICHRPT,Leucine-rich repeat signature

LNTLDLSYNSFTGQ

FPrintScan: PR00019
243-256 LEURICHRPT,Leucine-rich repeat signature

LPSLRQLNLSNNEL

Seg: seg
290-304 seg

SSPTPSQVPSPPKLP

Gene3D: G3DSA:3.30.200.20
328-470 no description

LAAVMFTMCISKRKEKKDEAGYNGKVTDGGRIEKRKEDLSSGVQMAHKNKLVFLEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEY

superfamily: SSF56112
IPR011009
363-673 Protein kinase-like (PK-like)
Protein kinase-like domain

KEDLSSGVQMAHKNKLVFLEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSAS

ProfileScan: PS50011
IPR000719
395-673 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSAS

HMMSmart: SM00220
IPR002290
395-665 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMV

HMMSmart: SM00219
IPR020635
395-665 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMV

HMMPfam: PF00069
IPR017442
399-663 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGSYGTAYKAILEDGSTVVVKRLKDVVAGKKEFEQQMELIGREVNMQTSRPIRAYYYSKDEKLVVYEYIGRGSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVR

PatternScan: PS00107
IPR017441
401-432 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSYGTAYKAILEDGSTVVVKRLKDVVAGK

Gene3D: G3DSA:1.10.510.10
474-673 no description

GSFSALLHGIKGVCEKTPLDWNTRMKIILGTARGLEHIHSEGGSRLAHGNIKSTNVLLDGDHNPYVSDYGLSSLTSLPITTSRAVAGYRAQETFESRKFTHKSDVYGFGVLLMETLTGKAPLQSQGQDDAVDLPRWVHSVVREEWTAEVFDVQLMKYPNIEDELVQMLRIAMACTAWSPDRRPTMAQVVRMVEELRHSAS

Seg: seg
544-555 seg

LSSLTSLPITTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox