PRGDB00063943 (Zm.6289)

From PRG Wiki
Jump to: navigation, search
Zm.6289
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195650326 (EU972513)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 382520 receptor-like protein kinase 5 precursor, mRNA, complete cds

DNA Sequence

ATTCGCACTCGTCTCTGTTTGGGTTCGTCGTCGTCAGGTACTCCTCCTTCCGGGCTCCACGCCGCGCGCGCCTTGGGCGACTGCCTTTTCGATTCGTCTTCCTTGATGCATATTTTCTCTTCCTGTAGGTAAATATCACGAGCACCATGCTCGAGTTCTTGTAGCTCCGCAGCTTCCTCGCTTCTTGCATCCTTTGCAACTTGTCTCCTGTTGTTTTCCTCTGATTTCCATGGAGGAAAGATGCTGGGTGTGCCAGTGATGTGGGCGTGGAGCAGGCAACAATTGGCTCGTCCTGGACATTGATCGATTCTCCCCTATTCTCGTCCAAGGAATTTTATTCGTTTCTCCTAGCAAGTCGTGTGTGCTTGTTTCGTGGAGGTAGGAGCTAGGATGACGAGCAGGAACCCTACCAAAACCCTGTCGGTCCTGACCACTCTCCTGCTGCTGCTTGAGTTCCTCGCGCTGTGCGCGCCCGCCTCCGCCCAGCCGCTCCACTCGGAGCCCATGGCGACGCAGTCCccgccgccgccgccgccgctgccgccgGGGTCCACGATTCCCCGGGCGCAGGCCGGCGGCGCCGCACGCCTCCGCCGCATTGCGCTCGGggtcctcttcggctctctctccggtttcctcctcgcgctcgccttcctctacgccatccgcctcGCCATCCTCCACGCCAAGAGCACGCCCGCGATCGCCAAGGGCCCCGTCTCCTTCGCCCCGCAAATCTCCGCCAAGAACCTCCTGGCCGCGCTCCCCGCCGCGCAGCCGCTCGCCCATGGGCCCCATGGCAAGTACTACAAGCTGGCACTCGACAACGACCTCACCGTCGCCGTCAAGCGCCTCGAGGCGGCCAGCCGCCCCGAGGCCTCGCCGTCCATGTCCCCGAGCGCGTCCAAGTCAGACATGAGGAGGGTGCAGAGGCAACTTGAGGCACTTGCTCGGGTCAGGCACCAGAATGTGTTGTCGTTGAAGGCGTACGTTCGCGAGGCGGACCGCCTCTCACTCGTGTACGACTTTGTCCATGGGGGCAGCCTCGAGGATCTGATGAAGAGGGTGAGGTCGCAGCAAGTCAGTCTCGGTTGGGATGCGAGGAGCAGGATTGCTGTTGGGATTGCCAAGGGACTGAGGCACTTGCATTTTGAGTGCAATCCGAGGATAGTCCACTGCAACCTCAAGCCGTCCAATGTGATGCTAGACGAAGGTTTGGAGCCATTATTGGCAGATTGTGGTGTTGCAAGGCTAATTGCAGCAGGTTCAGGTGATCCAGAATTGTGCACTGGCCTTTACGCTGCTCCAGAATGCTATCAAAGCAGCAGGTACACGGATAAGAGTGATGTGTACGCCCTTGGCATGATCCTGGGCGTGCTGCTCACTGGGAGAGACCCGACAGACTCTTTCTTCTCGGGAGAGACTACCGGGCAGGGCGGGGGCGGCCTCCCAAGATGGCTCCGGCACACGCAGCAGTCCGCGGACCCGAAAGAAACGCTGGATACCAGCATCCTGGGGGACGAGGGAGAAGAGGAGGAGATGCTGATGGCCATTCGGGTTGCCATTGTCTGCCTCTCGGACTCGCCAACCGACCGGCCATCCAGCGACGAGCTCGTCGCCATGCTAACGCAGCTCCACAGCTTATAATTAATCACCATATATCGCAAATTTCTTGAGCGCGGCGCCCGATCATGTTGGATCAGTGCTTCCTGTTTCACAGCTAGCACGGGTGAGTGCAGCAGATCTCGTTGTGTGGTGCTTGTGAGTCACAAGCGCCGAAATGGTCGACGAGGGAGCTGGCAGTTCAAGGCCATATAGGACAGGCGCAGGCGCAGGCGCTGTGTCCCCTGTACGATTCATCTGTGATGTAGTAGCTACTAGGTACAATACAAGATGGTGGTTGAGCTTCCTGGGTTGTTTTGCGCGTGGGTTGTGAATATGTCTTGGTAGaaaaaaaaactctgtgccgtgaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.6289 translated coding region predicted by ESTScan from UniGene Zm.6289

MATQSPPPPPPLPPGSTIPRAQAGGAARLRRIALGVLFGSLSGFLLALAFLYAIRLAILHAKSTPAIAKGPVSFAPQISAKNLLAALPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAMLTQLHSL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF919
1-377 SUBFAMILY NOT NAMED

MATQSPPPPPPLPPGSTIPRAQAGGAARLRRIALGVLFGSLSGFLLALAFLYAIRLAILHAKSTPAIAKGPVSFAPQISAKNLLAALPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAMLTQL

HMMPanther: PTHR24420
1-377 FAMILY NOT NAMED,FAMILY NOT NAMED

MATQSPPPPPPLPPGSTIPRAQAGGAARLRRIALGVLFGSLSGFLLALAFLYAIRLAILHAKSTPAIAKGPVSFAPQISAKNLLAALPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAMLTQL

Seg: seg
6-14 seg

PPPPPPLPP

Seg: seg
20-59 seg

RAQAGGAARLRRIALGVLFGSLSGFLLALAFLYAIRLAIL

Seg: seg
83-94 seg

LLAALPAAQPLA

ProfileScan: PS50011
IPR000719
87-380 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAMLTQLHSL

HMMSmart: SM00219
IPR020635
87-374 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAML

HMMSmart: SM00220
IPR002290
87-374 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LPAAQPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAML

Gene3D: G3DSA:3.30.200.20
91-161 no description

QPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKA

HMMPfam: PF00069
IPR017442
91-371 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELV

superfamily: SSF56112
IPR011009
91-374 Protein kinase-like (PK-like)
Protein kinase-like domain

QPLAHGPHGKYYKLALDNDLTVAVKRLEAASRPEASPSMSPSASKSDMRRVQRQLEALARVRHQNVLSLKAYVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELVAML

Seg: seg
119-136 seg

AASRPEASPSMSPSASKS

Gene3D: G3DSA:1.10.510.10
162-371 no description

YVREADRLSLVYDFVHGGSLEDLMKRVRSQQVSLGWDARSRIAVGIAKGLRHLHFECNPRIVHCNLKPSNVMLDEGLEPLLADCGVARLIAAGSGDPELCTGLYAAPECYQSSRYTDKSDVYALGMILGVLLTGRDPTDSFFSGETTGQGGGGLPRWLRHTQQSADPKETLDTSILGDEGEEEEMLMAIRVAIVCLSDSPTDRPSSDELV

Seg: seg
305-314 seg

GETTGQGGGG

Seg: seg
340-345 seg

EGEEEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox