PRGDB00063944 (Zm.6870)

From PRG Wiki
Jump to: navigation, search
Zm.6870
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195638943 (EU966822)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 297597 dihydroflavonol-4-reductase mRNA, complete cds

DNA Sequence

AAATAGGTAGATGATGCCGCTAACAGTAACACAGAGTAAAAGACTCCAATTTTCCCACGGCTACTGAATCACGGATGCTTAAATCTCCCCAATCCGTATCTCTGTTTCCCTCACAGCGCGGCTGCCTATAACCACTCCAGGTCTCCAGCGAAGCAGGCTCAGGCGCAACGCAACAACACAAGGCGGCGGTTATGGCCTCTGCTGCTGCGACGGCTACGATGGGGACGGGGAAGGTGGTGTGCGTCACCGGCGCATCAGGGTACATCGCGTCCTGGATTGTCAGGCTCCTCCTCGACCGCGGCTACACCGTCCGCGCCACCGTGCGAGACACCGCTGACCCAAAGAAAACATTGCACCTGACTGCGTTGGATGGTGCTAAGGATAGGCTGCACTTATTTAAAGCTAGCCTGCTAGAAGAGGGTTCTTTCGATGCTGCAGTTCATGGATGCGACACTGTATTTCATACTGCCTCTCCCTTTTATCACAATGTCAAGGATGCTAAGGCAGAGTTACTTGACCCAGCAGTTAAGGGAACACTCAATGTTCTCGGTTCATGCAAGAAAGCTTCTATTAAAAAGGTGGTTGTAACATCATCTATGGCTGCTGTAGCCTACAACGGGAGGCCAAGGACTCCTGAGGTCACAGTTGACGAGACATGGTTTTCTGATCCACAAATTTGTGAAACAAATCAGCAATGGTATATTTTGTCCAAGACGCTGGCAGAGGAGGCTGCTTGGAAGTTCTCAAGGGATAATGGACTTGAAATCGTTACTATAAACCCAGCGATGGTTATTGGTCCCCTGCTGCAGCCTACACTAAATACCAGTGCTGAAGCAATCCTGAAGTTAATCAATGGGTCATCGTCTACATATCCCAATTTTTGCTTTGGATGGGTTAATGTCAAGGATGTTGCCCTGGCCCATATCCTTGCATACGAGGTTCCCTCATCAAATGGAAGGTACTGCATGGTGGAAAGAGTTGTTCACTACTCAGAACTGGTGAACATTATCCGCAACATGTATCCTACCCTTCCTCTTCCGGACAAGTGTGCAGATGACAAGCCGTTTGTCCCACCCTACCAAGTATCAAAGGAGAAGATAAAAAGCATAGGCATCGAGTTGATTCCACTGGAGACGAGCGTCAAGGAGACCATCGAAAGCTTGAAAGAGAAGGGGTTCGCTAGTTTTTGACTCGTGCAAGCTGTGAAACAGAAGTGTTACTGTACTACGTGATGTTGCATTGTACACATGCATCGGACTTCGCAGTTCCCAAGCTATTTTGGTAGCTTTGGTCTGTAAGATTACCTAAAATAAACTGAGCCACGTTGCCACGCTGTAGCTTTTGTACATGTTATGCTTTGATCGGATTGAGACACGTGATATATGGTCGTTGCTTACaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.6870 translated coding region predicted by ESTScan from UniGene Zm.6870

MGTGKVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPSSNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIPLETSVKETIESLKEKGFASF

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
3-317 NAD(P)-binding Rossmann-fold domains

TGKVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPSSNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIPLETSVKETIESLKE

HMMPanther: PTHR10366
4-320 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

GKVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPSSNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIPLETSVKETIESLKEKGF

HMMPanther: PTHR10366:SF9
4-320 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

GKVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPSSNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIPLETSVKETIESLKEKGF

Gene3D: G3DSA:3.40.50.720
IPR016040
5-231 no description
NAD(P)-binding domain

KVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDV

HMMPfam: PF01370
IPR001509
7-246 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASLLEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKASIKKVVVTSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPSSNG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox