PRGDB00063948 (Zm.8052)

From PRG Wiki
Jump to: navigation, search
Zm.8052
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195651150 (EU972925)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 390216 dihydroflavonol-4-reductase mRNA, complete cds

DNA Sequence

CAAAAAATTTTTGCTCAGCCCGCTCTCGGACGAACCCATTCACCCGTCCGGCCGTCCGTGCGCGGCGCACCCACCCGGCACCGGCACCAGCACCACCGCCCGCCCGGCGCCCGTCACGCTCGAGAGGAGGAGGAAGAAGAAGGGACTGGGCGACAGCGCGCGATGGCCGCCGTCGTGTGCGTCACCGGCGCCGGCGGCTTCATCGGCTCGTGGATCGTCAAGATCCTCCTCGCCCGCGGGTACGCCGTCCGGGGCACCTCCCGCCGCGAAGCTGCTGACCCCAAGAACGCGCACCTGTGGGCGCTCGACGGCGCGGCGGAGCGCCTCACCATGCTGCAGGTGGACCTGCTCGACCGCGCCAGCCTCCGCGCCGCCTTCCGCGGCTGCGACGGCGTCATCCACACCGCCTCGCCGATGCACGACAACCCCGAGGAGATCATCGAGCCGATTATCGCCGGGACGCGGAACGTCGTGGAGGCGGCGGCGGACGCCGGCGTGCGGCGCCTGGTGCTGTCCTCCACCATCGGCACCATGTACATGGACCCGCGCCGCGACCCCGACGCCCCGCTCGGCGACTCCAGCTGGAGCGACCTCGAGTACTGCAAGAGCACCGAGAACTGGTACTGCTACGCAAAGACGGtggcggagcagggcgcgtgggaggcggcgcgggcgcgggggctggacctggcggTGGTCATCCCGGTGGTGGTGCTCGGCGAGCTGCTGCAGCCCAGCATGAACACCAGCACCCTGCACATCCTCAAGTACCTCACGGGACAGACAAAGGAGTACGTCAACGAGTCGCACGCCTACGTGCACGTCAGGGACGCCGCCGAGGCGCACGTAAGGGTGCTGGAGGCGCCCGGCGCCGGCGGCCGGCGGTACGTCTGCGCCGAGCGCACCCTGCACCGCGGCGAGCTCTGCCGCATCCTCGCCGGACTCTTCCCGGAGTACCCTATTCCGACAAGGTGCAAGGATCAGGTGAACCCACCGAAGAAGGGCTACAAGTTTACGAACCAACCTCTGAAGGACCTTGGCGTCAAGTTCACTCCAGTGCATGGGTACCTGTACGAAGCAGTGAAGTCCCTGCAAGACAAGGGCTTCCTCCCGAAGACCTCTGGCGCCAAGGTGCCTGAACGACGCAGCTACCTGCCTCAAACGACATCACAGCCACCACCCGAAATCGTTTCGAAACTTTGAGGTGGATCTGCACACGTGCTCAAACTGGCCATGttttttttttGTCAGAACAAGCCGTTCATTTGATTGGTTATTAAAAGATTTTGGGCAGTCTGTTCTTACaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaactcaaaccaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.8052 translated coding region predicted by ESTScan from UniGene Zm.8052

MAAVVCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVCAERTLHRGELCRILAGLFPEYPIPTRCKDQVNPPKKGYKFTNQPLKDLGVKFTPVHGYLYEAVKSLQDKGFLPKTSGAKVPERRSYLPQTTSQPPPEIVSKL

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
3-312 NAD(P)-bd

AVVCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVCAERTLHRGELCRILAGLFPEYPIPTRCKDQVNPPKKGYKFTNQPLKDLGVKFTPVHGYLYEAVKSLQD

Gene3D: G3DSA:3.40.50.720
IPR016040
4-262 NAD(P)-bd
NAD(P)-binding domain

VVCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVCAERTLHRGELCRILAGLF

HMMPanther: PTHR10366:SF9
4-336 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

VVCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVCAERTLHRGELCRILAGLFPEYPIPTRCKDQVNPPKKGYKFTNQPLKDLGVKFTPVHGYLYEAVKSLQDKGFLPKTSGAKVPERRSYLPQTTS

HMMPanther: PTHR10366
4-336 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VVCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVCAERTLHRGELCRILAGLFPEYPIPTRCKDQVNPPKKGYKFTNQPLKDLGVKFTPVHGYLYEAVKSLQDKGFLPKTSGAKVPERRSYLPQTTS

HMMPfam: PF01370
IPR001509
5-244 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIGSWIVKILLARGYAVRGTSRREAADPKNAHLWALDGAAERLTMLQVDLLDRASLRAAFRGCDGVIHTASPMHDNPEEIIEPIIAGTRNVVEAAADAGVRRLVLSSTIGTMYMDPRRDPDAPLGDSSWSDLEYCKSTENWYCYAKTVAEQGAWEAARARGLDLAVVIPVVVLGELLQPSMNTSTLHILKYLTGQTKEYVNESHAYVHVRDAAEAHVRVLEAPGAGGRRYVC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox