PRGDB00063951 (Zm.8240)

From PRG Wiki
Jump to: navigation, search
Zm.8240
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223943798 (BT061286)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0131J12 mRNA, complete cds

DNA Sequence

CGGCAAGGCGCCAAGGCGACCGGACAGGCCTAGGCGAAGCGGGCGCAGCTCCTGCCGGTGGTGGGTAGTGGCCCTAGCAATAAACATCTTGCCCAACCGGCTCTCGCTACGCGCCTACGCTTCGTCAACACCGGAACCGCCCCCACCCCGCCCCGAGCGCCAATTGCACCGCCGCTCCCGGCCAAACCGGCCAAGTCAACGGCGCATCCACTTCTCCTTACCATCCCGGAGGTAATCTTGCGCCGATTCGGTGCCGATTTGCGCCATCCGCGACCGGAGGCTCCGCCGGGTCTTGTGTTCTTGCGGGGCGGGGGCTCAGGACAACCTGGCCTCTGCTTGATTGGATTCGGGGCGTTCGGCGCCTCCAGCTCGCGATCTTTCCTGCCGGTTTCGTCGACCGCTGGTCAACCTGGCCGGTCGGTCCCGGGGGCTCTTCACCTCCGTGCTGCCTGCCACCGTCGCTTTAGTCAAGTCTCGGCCAAGATTTTAGCTATCTCCGGTCAAAAGGCTTTACCGATTCTTGGATTGGTGGCTTCTTGGGGGCGAGAAGCCGGTTCCTGTTTCGTCTCTTGTGCTCCAGCATGTTCTGTAGCACACCGGTTCCCCATCTCCAGTGAAGGTGTTCGTGTGCTCTTGGTTTTGTGCCTCCCGGAATCGTTCCCGGAAAGCTACTTTTGGCCGCTGCGGCGATGGCGTCGAGCACCAGCGAGATGGCCGAGGGGAAGGAGAAGCTGAAGAGGTCCGGCAGCTTGGGAAGCAACGATACGTATGTGCGTGCAGACAAGATTGATCTTACGAGCCTCGACATCCAGCTGGAGAACCAGCTCACCAAGACCTGGGGCAAAGCCAATCTCAAATCCCAGGGGCCAAAGGAGGAGTGGGAGATCGACCTTGCAAAGCTGGAGATCCGCTATGTCATCGCTCAGGGGACGTATGGCACGGTCTACCGGGGCACCTACGATGGACAGGACGTCGCAGTGAAGCTTTTGGATTGGGGAGAAGATGGTTTTGCCACAGAGGCTGAAACTGCTGCTTTACGAACATCATTTAAGACGGAGGTTGCTGTTTGGCATAAGCTCAGCCACCCTAATGTTACAAAGTTTGTTGGTGCATCTATGGGGACCACAGACCTTAAGATTCCATCAAACAATTCCAATGGTGCTGCACGTACAAATTTGCCAGCAAGAGCATGTTGTGTTGTGGTAGAGTATCTTGCTGGAGGAACTTTGAAGCAATATTTGATAAAGAATAGCCGACGGAAGCTTGCTTATAAAGTTGTGGTCCAGCTTGCATTGGATTTGGCCAGAGGATTGAGCTATCTGCACTCCAGAAAGATTGTACATCGGGATGTGAAAAGCGAAAACATGCTGCTTACTCCACAGAGAAACCTTAAGATTGCCGATTTCGGTGTTGCTCGTGTTGAGGCTCAGAATCCAAAGGACATGACTGGTGCAACAGGCACACTTGGTTATATGGCTCCAGAGGTTCTTGATGGTAAGCCATACAACAGGAAGTGTGATGTTTATAGTTTTGGCATTTGTTTATGGGAAATCTATTGCTGTGACATGCCTTACCCAGACCTAAGTTTTGCCGATGTCTCATCTGCCGTTGTTCACCAGAATTTGCGCCCAGACATTCCTCGCTGCTGCCCAAGCGCATTTGCGAATGTTATGCGGAAATGCTGGGATGCAAACCCTGATAAACGCCCTGATATGGATGAAGTGGTGCAGCTTTTAGAGGCTCTGGACACGAGCAAAGGCGGTGGCATGATACCTGATGGCCAATCATCAGGATGCTTATGCTTCACAAAGGCTCGTGGTCCATAGATACTTTTCATGGTACTCCCTTCCCTTGGCAACACTTTCCCCGTGTAAATGACTGGGCCACAGCATGCTTCTCTTTGCACGACCTGTGCAGTCGTCGCTTACAGTTCTCCATAGCTGCCTTGCGATCATTGCGTGTCAACCTGTAGCTCTCATACGATTTTTGCTGTCCTCTGTCGACAATCTTTTCATATACTAGTGTGCTGCTGTAATTGTGGTTCTAAAAGAGATTTGGCATACGCGTTACACTCTTGAAACTGCTGTATGATCAGTATAAATCTTTACTCTGATTATTATTTCCATTTGTGCT


Protein sequences

Name Description Sequence
Zm.8240 translated coding region predicted by ESTScan from UniGene Zm.8240

RQGAKATGQAXAKRAQLLPVVGSGPSNKHLAQPALATRLRFVNTGTAPTPPRAPIAPPLPAKPAKSTAHPLLLTIPEVILRRFGADLRHPRPEAPPGLVFLRGGGSGQPGLCLIGFGAFGASSSRSFLPVSSTAGQPGRSVPGALHLRAACHRRFSQVSAKILAISGQKALPILGLVASWGREAGSCFVSCAPACSVAHRFPISSEGVRXALGFVPPGIVPGKLLLAAAAMASSTSEMAEGKEKLKRSGSLGSNDTYVRADKIDLTSLDIQLENQLTKTWGKANLKSQGPKEEWEIDLAKLEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPDGQSSGCLCFTKARGPXILFMVLPSLGNTFPV

Domains

Domain Start-End Description Sequence

Seg: seg
1-15 seg

RQGAKATGQAXAKRA

Seg: seg
47-64 seg

APTPPRAPIAPPLPAKPA

Seg: seg
115-127 seg

GFGAFGASSSRSF

Seg: seg
224-240 seg

LLLAAAAMASSTSEMAE

HMMPanther: PTHR23257
268-614 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LDIQLENQLTKTWGKANLKSQGPKEEWEIDLAKLEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPDGQSSGCLCFTKARGPXILFMV

HMMPanther: PTHR23257:SF276
268-614 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LDIQLENQLTKTWGKANLKSQGPKEEWEIDLAKLEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPDGQSSGCLCFTKARGPXILFMV

Gene3D: G3DSA:3.30.200.20
278-376 no description

KTWGKANLKSQGPKEEWEIDLAKLEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTT

superfamily: SSF56112
IPR011009
287-577 Protein kinase-like (PK-like)
Protein kinase-like domain

SQGPKEEWEIDLAKLEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQ

ProfileScan: PS50011
IPR000719
301-582 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEAL

HMMSmart: SM00220
IPR002290
301-582 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEAL

HMMSmart: SM00219
IPR020635
301-579 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLL

HMMPfam: PF07714
IPR001245
302-579 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EIRYVIAQGTYGTVYRGTYDGQDVAVKLLDWGEDGFATEAETAALRTSFKTEVAVWHKLSHPNVTKFVGASMGTTDLKIPSNNSNGAARTNLPARACCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLL

Gene3D: G3DSA:1.10.510.10
398-581 no description

CCVVVEYLAGGTLKQYLIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFANVMRKCWDANPDKRPDMDEVVQLLEA

FPrintScan: PR00109
IPR001245
402-415 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VEYLAGGTLKQYLI

FPrintScan: PR00109
IPR001245
440-458 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHSRKIVHRDVKSENMLL

PatternScan: PS00108
IPR008271
446-458 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKSENMLL

FPrintScan: PR00109
IPR001245
506-528 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDVYSFGICLWEIYCCDMPYPDL

FPrintScan: PR00109
IPR001245
550-572 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CPSAFANVMRKCWDANPDKRPDM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox