PRGDB00063966 (Zm.10597)

From PRG Wiki
Jump to: navigation, search
Zm.10597
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18175655 (BM350890)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

MEST270-C09.T3 ISUM5-RN Zea mays cDNA clone MEST270-C09 3', mRNA sequence

DNA Sequence

TTTTTTTTnnnnnnnnnnnnnAAAAGCAAAACCATGTATTCCATATTTCAGTACGGATAACATGTTGACAGCCATGGTACTCTAGGAAAAAGTTCATAGGGAGCAAAAATTCACATGAACTAGGAAGGTTTGGGTGGCGCCAGTGAACATGTATGGAGCAGGCGACTCTTGTTTTATGGATGCTGAGGCTGCATTAATTTTGAATCGCAGGCCACGATCTTCACCCTTCCCAGTGTTTCTTGAATCTCCTCGCTCTTGAAGGTTGCATCTGTTAGAATGAAGGTCCAGACATTGTCGCAGAACCTGTAGGTGTGCAGGTGGCCCTTGACGCTGACCTTGCTCTTGACCTGCATCTCCAGCGCCTCAGTCATGGACTTGTCGAACTGCACAAGGACCTGGATGGCGAGCTCCGGGCTGACGGCCCCGCTGGAGACGAGCTCGTCCAGCGTCTCGGTGAGGCAGGTGCCAATGGTGGACCTCCGGTAGAGCTCGAATGTGGCCATCCCCTGGCGGATTGGGCGAGGAGGAACGGCGCAAGAGCAGGCCTTGACGGACGGAGGCGGAGCACAG


Protein sequences

Name Description Sequence
Zm.10597 translated coding region predicted by ESTScan from UniGene Zm.10597

XCAPPPSVKACSCAVPPRPIRQGMATFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALEMQVKSKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDSKLMQPQHP

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF009415
IPR003194
22-130 Transcription initiation factor IIA, gamma subunit
Transcription initiation factor IIA, gamma subunit

QGMATFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALEMQVKSKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDSKLMQPQ

BlastProDom: PD009224
IPR015872
24-73 Q7FPX2_ORYSA_Q7FPX2;
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALE

Gene3D: G3DSA:1.10.287.190
IPR015872
24-77 no description
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALEMQVK

HMMPanther: PTHR10966
IPR003194
24-126 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALEMQVKSKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDSKL

HMMPfam: PF02268
IPR015872
26-73 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

TFELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALE

superfamily: SSF47396
IPR009083
27-77 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGTCLTETLDELVSSGAVSPELAIQVLVQFDKSMTEALEMQVK

HMMPfam: PF02751
IPR015871
75-124 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDS

superfamily: SSF50784
IPR009088
75-125 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDSK

Gene3D: G3DSA:2.30.18.10
IPR009088
78-128 no description
Transcription factor IIA, beta-barrel

SKVSVKGHLHTYRFCDNVWTFILTDATFKSEEIQETLGRVKIVACDSKLMQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox