PRGDB00063977 (Zm.12924)

From PRG Wiki
Jump to: navigation, search
Zm.12924
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 54651385 (BT016604)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone Contig437 mRNA sequence

DNA Sequence

GCACGACGTTCTACATCTTTCCCATCCAGCTAGCAGCAGTTAATAAATTAAAAAGAGATGACGGAGAAGGTGCTAGTTCTGATCGTTGGTGCAGGTCCATCAGGCCTTGCTGTAGCAGCATGCCTCGGCGAGCACGGCATCCCGTACCACATTGTGGAGCGCGAGGACTGCAGCGCTTCGCTGTGGCGCAAACGCACGTACGATCGCCTCAAACTCCACCTCGCCAAGGAGTTCTGCGAGCTCCCTCGCATGTCGCATCCGAGCGACGCCCCCAAGTACATCACGAGGGAGCAGTTCGTGAGGTACGTCGACGACTACGTCGAGCGCTTCAACATCCTCCCCAGGTACAGCACCTCGGTCGAGTCCTGCGAGTACGACGAGGCCAGCGGCCGCTGGGACGTCAGAGCGCGTGACCTAGCGGACGGCGGCGGCCGAGTGGCCGAGTACACGGCCAGGTTCTTGGTCGTAGCCACCGGCGAGAACTGCGAGGGTGTCATCCCGGATATCCCTGGCCTGCGCGATTTCCCGGCTGGTGAGGTCGTGCACTCGTCGAGCTACAAATCGTGGAAGAACTATGCCGGGAAGAGAGTCCTGGTGGTTGGGTGTGGCAACTCTGGCATGGAGATTGCATATGATCTTGCCTACAATGGAGTGGAAACCTCCTTGGTTATCCGTAGCCCGGTGCATGTTATGACCAAGGGTCTGATTTACTTGGGCATGAGGCTGCTGAAATGGCACCTTCCCGTGAAACTTGTGGACTTCATCATCTTGACCTTGGCAAACATCCAGTTCGGTGACCTCTCCCGCTACGGCATAGTCAGGCCCGACATGGGCCCGCTTCTTCTCAAGGCCAAGACTGGCCGGTCGGCGGTCCTAGACGTTGGCACAACCCAGTTAATAAAGACGGGCGATATCAAGGTGGTTGGGGCGATATCTCGCATCAGAGGAAACACAGTGGAGTTCGAGGATGGGAAGGAGAGGGACTTCGATTCTCTCGTGTTCGCAACAGGATACAGAAGCACTGCGAACACGTGGCTTAAGGACGGTGGGAGCTTGCTAGACGACAATGGCATGCCGAAGAAGAAGGCGGGGCTGCAGCAGGGCAGTCGTCCATGGAAGGGCGGCAACGGGCTCTACTGCGTTGGGCTGGGGATGGCTGGACTGGCTGGCATCTCTCGTGACGCAGTGAGCGTTGCTGCGGACATCAAGGCCGCGGTGGATTCCATGGTGGGGCCGCCGGCGTTCTGGTTCTGATCGAACAGCTTAGATCTATCTGCTAGCTCGATCGTCGATGCATGGACGGAGTGAAGAATAATAACGTTACGTACGTACGTACCGCGCGATCGATAGGAGATCATCGATCTCCATCCATCCGATGTGTGGTGCGTGCGTGCTGCTGGTTAAGAATAATTAAGTAAGAGTGTTTGTTATTGGCTAGCTATATATAGCTAGCTTTGTGAACGTACCCTTTATTGTCtgtgtgtgcagtgtgtgtgtTGTACCGTCGTTCCGCTAGCTCTGTGTTTGTTTCCTTGATAGCAGCTTTGTGTTTGTATATATGTGTGTCGTGTTTAATTAATATTTATATATGCTGTCATTTGTCATaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.12924 translated coding region predicted by ESTScan from UniGene Zm.12924

MTEKVLVLIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPVHVMTKGLIYLGMRLLKWHLPVKLVDFIILTLANIQFGDLSRYGIVRPDMGPLLLKAKTGRSAVLDVGTTQLIKTGDIKVVGAISRIRGNTVEFEDGKERDFDSLVFATGYRSTANTWLKDGGSLLDDNGMPKKKAGLQQGSRPWKGGNGLYCVGLGMAGLAGISRDAVSVAADIKAAVDSMVGPPAFWFXSNSLDLSASSIVDAWTE


Domains

Domain Start-End Description Sequence

superfamily: SSF51905
1-209 FAD/NAD(P)-binding domain

MTEKVLVLIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPV

ProfileScan: PS51257
1-22 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MTEKVLVLIVGAGPSGLAVAAC

FPrintScan: PR00411
6-28 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LVLIVGAGPSGLAVAACLGEHGI

Gene3D: G3DSA:3.50.50.60
7-190 no description

VLIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEI

FPrintScan: PR00368
IPR013027
7-26 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

VLIVGAGPSGLAVAACLGEH

HMMPanther: PTHR23023
7-384 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

VLIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPVHVMTKGLIYLGMRLLKWHLPVKLVDFIILTLANIQFGDLSRYGIVRPDMGPLLLKAKTGRSAVLDVGTTQLIKTGDIKVVGAISRIRGNTVEFEDGKERDFDSLVFATGYRSTANTWLKDGGSLLDDNGMPKKKAGLQQGSRPWKGGNGLYCVGLGMAGLAGISRDAVSVAADIK

HMMPanther: PTHR23023:SF5
7-384 MONOOXYGENASE,MONOOXYGENASE

VLIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPVHVMTKGLIYLGMRLLKWHLPVKLVDFIILTLANIQFGDLSRYGIVRPDMGPLLLKAKTGRSAVLDVGTTQLIKTGDIKVVGAISRIRGNTVEFEDGKERDFDSLVFATGYRSTANTWLKDGGSLLDDNGMPKKKAGLQQGSRPWKGGNGLYCVGLGMAGLAGISRDAVSVAADIK

HMMPfam: PF13738
8-209 Pyr_redox_3,Pyridine nucleotide-disulphide oxidoreductase

LIVGAGPSGLAVAACLGEHGIPYHIVEREDCSASLWRKRTYDRLKLHLAKEFCELPRMSHPSDAPKYITREQFVRYVDDYVERFNILPRYSTSVESCEYDEASGRWDVRARDLADGGGRVAEYTARFLVVATGENCEGVIPDIPGLRDFPAGEVVHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPV

FPrintScan: PR00411
135-144 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LVVATGENCE

superfamily: SSF51905
162-369 FAD/NAD(P)-binding domain

VHSSSYKSWKNYAGKRVLVVGCGNSGMEIAYDLAYNGVETSLVIRSPVHVMTKGLIYLGMRLLKWHLPVKLVDFIILTLANIQFGDLSRYGIVRPDMGPLLLKAKTGRSAVLDVGTTQLIKTGDIKVVGAISRIRGNTVEFEDGKERDFDSLVFATGYRSTANTWLKDGGSLLDDNGMPKKKAGLQQGSRPWKGGNGLYCVGLGMAGL

FPrintScan: PR00411
177-202 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

RVLVVGCGNSGMEIAYDLAYNGVETS

FPrintScan: PR00368
IPR013027
177-195 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEIAYDLA

Gene3D: G3DSA:3.50.50.60
260-398 no description

PLLLKAKTGRSAVLDVGTTQLIKTGDIKVVGAISRIRGNTVEFEDGKERDFDSLVFATGYRSTANTWLKDGGSLLDDNGMPKKKAGLQQGSRPWKGGNGLYCVGLGMAGLAGISRDAVSVAADIKAAVDSMVGPPAFWF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox