PRGDB00063995 (Zm.16191)

From PRG Wiki
Jump to: navigation, search
Zm.16191
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194688727 (BT033443)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0224N06 mRNA, complete cds

DNA Sequence

TTGCTACAGCGGGGAGACGGCTAGGCCAATAAAAACACAGGCAATCGAATAGAAGTTTTTTTAAAAAAGGAAGGGGAGAAGAGCTAGAGGGGATGGGTGGCGGCACGGTGGTGTGTGTCACCGGCGGCAGCGGCTACCTCGGGAGCTGGCTCGTCAGGAAGCTCCTCGGCAGAGGCTGCGTCGTCCACGCCACCCTGCGGAGCCTCGCGGACGAGAAGAAGACGGGGCTGCTCCGGGCGCTCCCCGGCGCGGCGGAGCGGCTGCGGCTGTTCGAGGCGGACATGTACGACGCCGACACCTTCGAGCCCGCCATCGCCGGCTGCCACTTCGTCTTCCTCGTCGCCACGCCCCTGACGCACGACCCCACCAGCACCAAGTACAAGAACACGACGGAGGCGGCGGTGGACGCGGCGCGCATCATCCTCCGGCAGTGCGCGCTGTCCGGCACGGTGAAGCGCGTCATCCACACGGCCTCGGTCACGGCCGCGTCGCCGCTCAAGGAGGACGGCAGCGGGTACAAGGACTTCGCCGACGAGTCCAATTGGACGCCGCTCAACCTCTCCTACGAATTCACCAACGCTTACCTGGACGACTACGTGCGGTCCAAGACGCTGTCGGAGAAGGAGCTACTGAGCTActcctctttctcatcctcctcctcctcctcctcctcctccAAGGAAGACGACCGGCCCCAGGCGTTGGAGGTGGTCACCCTAGCGTGCGGGCTCGTCGGCGGCGACAGCATCCAGACGTACCTGTGGGGCAGCTACGCCGCGATCGTCGCGCCGCTGACGGGGCAGGCGGTCAGTCACAACGCCCTCCTCTTCTTGCAGGCGCTGCTGGGCTCCGTGCCGCTGGTGCACGTGGAGGACGTCTGCGAGGCCCACGTCTTCTGCATGGAGCAGGAGTCCATGGCCGGCCGCTTCCTCTGCGCCGCCGGGTACCCCAACATGCGTGACATGGTCGACCACTTTGCCGCAAAGCACCCCGACCTCAAGATACAGCTGACTCAGGTGACCGGAGAAGGTGTCAGGATTCAGCCCAACACCAGCAAGCTGGAGGACTTGGGGTTCAGATTCAAGTACGGAGTGGAGGAGACGCTGGACTGCAGCGTCGAGTGCGCCAAGAGGCTGGGAGAGCTCTAGATGCATGCTACACATGCATGCGCAGCATTGGAATTCAGCGACTGTGATACGAGTAAGTATGGTGGTATCATGTTAATACGTGTGTATATTGGGTCGATTCATCCCACCAGAGTTTGAACTGTTCCATATTCCCATCTGTTTCCCGTGATCATAAAATAAAAACAGTAAAATACATCAACGGTCATCAAACTT


Protein sequences

Name Description Sequence
Zm.16191 translated coding region predicted by ESTScan from UniGene Zm.16191

MGGGTVVCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAAKHPDLKIQLTQVTGEGVRIQPNTSKLEDLGFRFKYGVEETLDCSVECAKRLGELXMHATHACAALEFSDCDTSKYGGIMLIRVYIGSIHPTRV

Domains

Domain Start-End Description Sequence

Seg: seg
2-14 seg

GGGTVVCVTGGSG

superfamily: SSF51735
4-347 NAD(P)-binding Rossmann-fold domains

GTVVCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAAKHPDLKIQLTQVTGEGVRIQPNTSKLEDLGFRFKYGVEETLDCSVECAKR

Gene3D: G3DSA:3.40.50.720
IPR016040
5-297 no description
NAD(P)-binding domain

TVVCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAA

HMMPanther: PTHR10366:SF81
7-371 OS07G0601100 PROTEIN,OS07G0601100 PROTEIN

VCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAAKHPDLKIQLTQVTGEGVRIQPNTSKLEDLGFRFKYGVEETLDCSVECAKRLGELXMHATHACAALEFSDCDTSK

HMMPfam: PF01370
IPR001509
7-276 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMA

HMMPanther: PTHR10366
7-371 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLFEADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTVKRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELLSYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVSHNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAAKHPDLKIQLTQVTGEGVRIQPNTSKLEDLGFRFKYGVEETLDCSVECAKRLGELXMHATHACAALEFSDCDTSK

Seg: seg
171-197 seg

SKTLSEKELLSYSSFSSSSSSSSSSKE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox