PRGDB00063997 (Zm.16280)

From PRG Wiki
Jump to: navigation, search
Zm.16280
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614829 (EU957127)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1583615 receptor-like kinase mRNA, complete cds

DNA Sequence

AGCTGTAAGCCTGTATAACAAATGATCCAATCTTTACATACATAGCTAGCTGACGTGCATGATTCCGTGTGCAACGACAAACATACATCGCACATGGCGGTTCTCAACCTCCTCGCCTTGATCATTGCCACGCTACTGCTACTTTTCAGAAGAACCTCCGGCGCCGGCATTTCGCCGGCGGACACGCTCAACAGCGGGGGCAACGTCACCGATGGCGAGACGCTGGTCTCGGCCGGTGGCACATTCACCCTGGGCTTCTTCTCCCCGTCGACCACGGTGCTGACCAAGAGGTACCTCGGGATCTGGTTCACGGCGTCTGGTACGGACGCCGTCTTGTGGGTGGCCAACCGCGAAACCCCGCTAAACAACACCTCCGGCGTCCTGGTGATGAGCAGCCGGGTGGGCCTTCGCCTTCTCGACGGCTCTGGCCGGACCGCCTGGTCCTCAAACACGACCGGCGCCTCCACCTCTTCGGTGGCACAGCTGCTCGGGTCCGGCAACCTCGTCGTGCGCGAGAAGAGCAGCAACGCCGTCTTCCAGTGGCAGTCGTTCGACCATCCGCAGAACACCTTGCTCGCCGGCATGAGGTTCGGCAAGAACCTAAAGACCGGCATGGAGTGGTCCCTGACGTCGTGGCGGGCGCAGGACGACCCCGCGACGGGGGACTACCGTCGTGTCATGGACACGAAGGGCCTTCCGGACATCGTTACTTGGCACGGCAACGCCAAGAAGTACCGCGCGGGTCCGTGGAACGGGCGCTGGTTCAGCGGCGTGCCGGAGATGGACTCAGGGTACAAGCTGTTCTCCGTCCAGATGGTGGACGGCCCGGACGAGGTCACCTACGTGCTCAACACCACGGCCGGCATCCCCTTCACCCGCGTGGTGCTGGACGAGGTTGGCAAGGTGCGGGTCCTGATGTGGCTGCCGACCAGCCGGGTGTGGAAGGAATACCCATGGCTGCCGCGCGACGCCTGCGACGAGTACACGTCCTGCGGCGCGTTCGGCCTGTGCAACGTCGACGCCGCGCCGACGCCGTCCTGCAGCTGCGCCGTGGGGTTCAGCCCCGTGAACGCGTCGGAGTGGTCCAGGAGGGAAGCCTCCGGCGGGTGCCAGAGGGACGTGCCGCTGGAGTGCGCCGCCGGCAACGGGACGGCGGTGACGGACCGGTTCGCGCCCGTGCACGGCGTGAAGCTCCCTGACACGGACAACGCGACGGTGGACATGGGCGCGACGCTGGAGCAGTGCAAGGCGAGGTGCCTCGCCAACTGCTCGTGCGTGGCCTATGCCCCCGCCGACATCCGAGGCGGCGGCGATGGCAGCGGCTGCGTCATGTGGAAGGATAACATCGTTGATGTCCGGTACATAGAAAATGGGCAGGATCTGTTTCTGAGGTTGGCCAAGTCTGAATCAGCTACAGGGGAGAGGGTCCGTCTGGCAAAGATTTTGGTTCCAGTGATGGCGTTTGTGCTTGCACTCACGGCCGCCGGCATGTACCTTGCTTGGAACTGCAAGCTTAGAGCCAAGCGTCGGAACAGGGATAATTTGAGGAAAGCGATCCTAGGATACTCGACTGCGCCAAACGAACTCGGTGATGAAAACGTAGAGCTCCCATTTGTCAGCCTTGGAGAGATTGCTGCAGCAACAAATAATTTTTCCGAGGACAACATGCTTGGGCAAGGTGGCTTTGGGAAGGTCTATAAGGGTACGCTGGGACAGAACGTGCAGGTTGCAATCAAAAGGCTCGGCCAATGTTCAGGACAGGGCGTGGAGGAGTTCAGGAACGAAGCCGTCCTGATCGCGAAGCTGCAGCACAGGAACCTGGTCAGGCTTCTTGGATGCTGCATCGACGGAGACGAGAAGCTGCTAGTCTACGAATACTTACCGAACAGAAGCCTGGACTCCATTATTTTTGATGCTGCAAGTAAACACCTCCTTGATTGGCCAACACGTTTCAAGATAATCAGAGGAGTATGTCGAGGGCTCCTTTATCTCCACCAGGACTCAAGGCTGACTATAATCCACAGAGACCTGAAGACGAGCAACATACTGCTGGACGCAGATATGAGCCCCAAGATATCGGATTTCGGCATGGCAAGAATCTTTGGTGGAAACCAGCATGAAGCGAACACCAATCGAGTTGTTGGGACGTACGGTTACATGTCTCCTGAATATGCAATGGACGGCGTGTTTTCTGTCAAGTCAGACACGTACAGTTTCGGCGTCATAGTCTTGGAGATCATAAGTGGCCTGAAGATCAGTTTAACCCATTGCAATGGCTTCCCTAACCTGCTAGCTTATGCATGGAGCTTGTGGATAGACGACAGAGCCATGGATCTCGTGGACTCGTCCCTGGAGAAGAGCAGTTCCTGCAGTGAAGCTTTACGCTGTATCCAGATCGGACTGCTGTGTGTGCAGGACAACCCGAATAGTAGGCCGCTCATGTCGTCGGTGGTGACCATGCTCGAGAACGAAAGTACGCCACTTGCAGTGCCGATACAGCCAATGTATTTCTCATACCGGGGACTGGGAGGGACGGGAGAAGAAAATAATACTAGCAGTTCTGTGAATGGCATGAGCCTCACGACAATGTTAGTGGGACGATAGTTGTTGTTTATTATATTATACCTCCGTTTTTGTTGGAACAGATGTGTAATAGCGCATTAGCAGCTTATATTGTTCTAGAGAAGTCATATATTTATATATCGATTGCTATaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.16280 translated coding region predicted by ESTScan from UniGene Zm.16280

MAVLNLLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQMVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRNRDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLAVPIQPMYFSYRGLGGTGEENNTSSSVNGMSLTTMLVGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-809 PTHR24420,FAMILY NOT NAMED

LLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQMVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRNRDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLAVPIQPMYFSYR

HMMPIR: PIRSF000641
IPR024171
6-836 SRK
S-receptor-like serine/threonine-protein kinase

LLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQMVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRNRDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLAVPIQPMYFSYRGLGGTGEENNTSSSVNGMSLTTMLVGR

HMMPanther: PTHR24420:SF432
6-809 PTHR24420:SF432,SUBFAMILY NOT NAMED

LLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQMVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRNRDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLAVPIQPMYFSYR

ProfileScan: PS50927
IPR001480
29-152 BULB_LECTIN
Bulb-type lectin domain

ADTLNSGGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQS

HMMSmart: SM00108
IPR001480
35-156 B_lectin
Bulb-type lectin domain

GGNVTDGETLVSAGGTFTLGFFSPSTTVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHP

superfamily: SSF51110
IPR001480
68-187 B_lectin
Bulb-type lectin domain

LGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDP

Gene3D: G3DSA:2.90.10.10
IPR001480
79-158 Bulb-type_lectin_dom
Bulb-type lectin domain

AVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQN

HMMPfam: PF01453
IPR001480
79-187 B_lectin
Bulb-type lectin domain

AVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNTTGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTSWRAQDDP

Gene3D: G3DSA:2.90.10.10
IPR001480
190-226 Bulb-type_lectin_dom
Bulb-type lectin domain

GDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSG

HMMPfam: PF00954
IPR000858
214-325 S_locus_glycop
S-locus glycoprotein

YRAGPWNGRWFSGVPEMDSGYKLFSVQMVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPV

ProfileScan: PS50026
IPR000742
290-328 EGF_3
Epidermal growth factor-like, type 3

PRDACDEYTSCGAFGLCNVDAAPTPSCSCAVGFSPVNAS

ProfileScan: PS50948
IPR003609
347-435 PAN
Apple-like

CAAGNGTAVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRLA

HMMPfam: PF08276
IPR013227
354-421 PAN_2
PAN-2 domain

AVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDV

HMMSmart: SM00473
IPR003609
354-434 PAN_AP
Apple-like

AVTDRFAPVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVDVRYIENGQDLFLRL

Gene3D: G3DSA:2.60.120.200
IPR013320
438-540 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

ESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRNRDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLG

superfamily: SSF56112
IPR011009
490-798 Kinase_like
Protein kinase-like domain

GYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLA

ProfileScan: PS50011
IPR000719
520-805 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEDNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTMLENESTPLAVPIQPMY

HMMPfam: PF07714
IPR001245
523-790 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DNMLGQGGFGKVYKGTLGQNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSVVTML

PatternScan: PS00107
IPR017441
526-548 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGKVYKGTLGQNVQVAIK

Gene3D: G3DSA:3.30.200.20
541-582 G3DSA:3.30.200.20

QNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGC

Gene3D: G3DSA:1.10.510.10
583-786 G3DSA:1.10.510.10

CIDGDEKLLVYEYLPNRSLDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLKISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSRPLMSSV

PatternScan: PS00108
IPR008271
641-653 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox