PRGDB00063998 (Zm.16538)

From PRG Wiki
Jump to: navigation, search
Zm.16538
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224033648 (BT069003)
Gene Class N
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0124M24 mRNA, complete cds

DNA Sequence

GATCCTCCCATTTGTCCCGCTCTCGCTCACCTTTGACAACATCAAATACTCTGTTGACATGCCACAGGAAATGAAAGCTCAAGGTGTACAAGAAGATCGTTTGGAGCTCCTCAAAGGTGTCAGTGGATCTTTTAGGCCGGGTGTGTTGACCGCACTGATGGGCGTTAGCGGTGCAGGAAAAACTACTTTGATGGATGTGTTGGCTGGGAGAAAGACAGGTGGATACATTGAAGGAGACATCCGTATTTCAGGATACCCAAAGAAACAAGACACCTTTGCACGTGTATCAGGATACTGTGAACAAAATGATATCCACTCGCCACAGGTGACAGTCTATGAGTCCCTGCTTTTCTCAGCATGGCTCCGGCTTCCCAAGGACGTCGATTCAAACAAAAGAAAGATCTTCATTGAGGAGGTGATGGAGCTTGTGGAGCTGAAACCACTGAGAAATGCTTTGGTTGGACTTCCTGGAGTGAATGGTCTGTCAACTGAGCAGAGGAAAAGGCTTACCATTGCTGTGGAACTTGTTGCAAATCCATCTATCATCTTTATGGATGAGCCAACCTCAGGGCTTGATGCCCGAGCAGCTGCAATTGTGATGCGGACGGTGAGGAACACTGTCGATACTGGTAGAACTGTGGTCTGCACGATACATCAGCCTAGCATTGACATATTTGAAGCATTTGATGAGCTTTTCCTCATGAAGCGTGGTGGAGAAGAGATCTATGCTGGTCCACTTGGACATCATTCTTCAGATCTAATCAAGTATTTTGAGTCACTTCATGGGGTCAGCAAAATTAAAGATGGCTACAATCCAGCAACATGGATGCTGGAAGTGACCACAACTTCTCAGGAACAGATTCTAGGTGTTGATTTCAGTGACATATACAAGAAATCTGAACTCTACCAGAGGAACAAGGCCTTGATAAAGGAATTGAGCCAACCAGCACCAGGTTCAACTGACCTGCATTTCCCTAGCAAGTATGCGCAGTCTTCCATTACACAATGCGTGGCTTGCCTATGGAAGCAGAACCTGTCATACTGGAGGAACCCTCCTTACAATACCGTTAGGTTCTTTTTCACTACCATCATTGCTCTCCTCCTTGGCACCATCTTTTGGGACCTCGGCGGCAAAACGTATACATCACAAGACTTGATGAATGCCATGGGATCAATGTACTCTGCGGTGCTGTTCATTGGAGTCATGAATTGTACCTCAGTTCAGCCAGTGGTGGCCGTGGAGCGAACAGTCTTTTACCGTGAAAGAGCTGCTGGCATGTACTCAGCTTTCCCATACGCGTTTGGCCAGGTTGTCATTGAGCTTCCATACGCACTGGCTCAGGATATCCTTTACGGTGTCATAGTGTACTCTATGATAGGGTTCGAGTGGACGGCTGCTAAGTTCTTCTGGTACCTCTTCTTTGGGTACTTCACGCTGCTCTACTTCACATTCTACGGCATGATGGCCGTGGGGCTGACACCTAACTACCACATCGCCGCGATCGTCTCCTCGGCATTCTACGCCATCTGGAACCTCTTCTCCGGGTTCATCATCCCCCGACCGAAAGTGCCGATCTGGTGGAGGTGGTACTGCTGGATATGCCCCGTGGCGTGGACGCTGTACGGGCTGGTTGTGTCACAGTTCGGTGACGTCATGACTCCGATGGACGACGGAAGGGCCGTGAAGGTGTTCGTCGAGGACTACTTCGGCTTCAAGCACAGCTGGCTTGGGTGGGTGGCCGCCGTGGTGGTGGCGTTCGCCGTGCTCTTTGCGACCCTGTTTGGCTTTGCCATCATGAAGCTTAACTTCCAGAAGAGATAATGACGATAGGAGTTGGGAAATCACCTCCTAGGAGACAAAGGGATTTTTGCATTCGTTGGGTCGTGCAAGTAGATTTGACTGTGCATATTGGGAGAGTACGCCATAATATATGGATTCGTTGATTAGTTAAAGTTATAGAAGTTATTGTGTGCTCCTGttttttttttttgataggatattgtgctcctgtttttttttGATAGGATATATTGTGCTCCTTTTCTAGGAGGGTGATGCCGTAGTACTTTGTAAAGAATATTTCACACATCCAGTAAAATTCCTTGTCGCCCCTTGC


Protein sequences

Name Description Sequence
Zm.16538 translated coding region predicted by ESTScan from UniGene Zm.16538

XILPFVPLSLTFDNIKYSVDMPQEMKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSSDLIKYFESLHGVSKIKDGYNPATWMLEVTTTSQEQILGVDFSDIYKKSELYQRNKALIKELSQPAPGSTDLHFPSKYAQSSITQCVACLWKQNLSYWRNPPYNTVRFFFTTIIALLLGTIFWDLGGKTYTSQDLMNAMGSMYSAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYALAQDILYGVIVYSMIGFEWTAAKFFWYLFFGYFTLLYFTFYGMMAVGLTPNYHIAAIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWICPVAWTLYGLVVSQFGDVMTPMDDGRAVKVFVEDYFGFKHSWLGWVAAVVVAFAVLFATLFGFAIMKLNFQKR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
2-607 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

ILPFVPLSLTFDNIKYSVDMPQEMKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSSDLIKYFESLHGVSKIKDGYNPATWMLEVTTTSQEQILGVDFSDIYKKSELYQRNKALIKELSQPAPGSTDLHFPSKYAQSSITQCVACLWKQNLSYWRNPPYNTVRFFFTTIIALLLGTIFWDLGGKTYTSQDLMNAMGSMYSAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYALAQDILYGVIVYSMIGFEWTAAKFFWYLFFGYFTLLYFTFYGMMAVGLTPNYHIAAIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWICPVAWTLYGLVVSQFGDVMTPMDDGRAVKVFVEDYFGFKHSWLGWVAAVVVAFAVLFATLFGFAIMKLNFQKR

HMMPanther: PTHR19241
2-607 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

ILPFVPLSLTFDNIKYSVDMPQEMKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSSDLIKYFESLHGVSKIKDGYNPATWMLEVTTTSQEQILGVDFSDIYKKSELYQRNKALIKELSQPAPGSTDLHFPSKYAQSSITQCVACLWKQNLSYWRNPPYNTVRFFFTTIIALLLGTIFWDLGGKTYTSQDLMNAMGSMYSAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYALAQDILYGVIVYSMIGFEWTAAKFFWYLFFGYFTLLYFTFYGMMAVGLTPNYHIAAIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWICPVAWTLYGLVVSQFGDVMTPMDDGRAVKVFVEDYFGFKHSWLGWVAAVVVAFAVLFATLFGFAIMKLNFQKR

ProfileScan: PS50893
IPR003439
10-262 ABC_TRANSPORTER_2
ABC transporter-like

LTFDNIKYSVDMPQEMKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSSDLIKYFESLH

Gene3D: G3DSA:3.40.50.300
11-246 no description

TFDNIKYSVDMPQEMKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGP

superfamily: SSF52540
25-239 P-loop containing nucleoside triphosphate hydrolases

MKAQGVQEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG

HMMSmart: SM00382
IPR003593
47-239 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG

HMMPfam: PF00005
IPR003439
62-190 ABC_tran
ABC transporter-like

TTLMDVLAGRKTGGYIEGDIRISGYPKKQDTFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPKDVDSNKRKIFIEEVMELVELKPLRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
335-549 ABC2_membrane
ABC-2 type transporter

TQCVACLWKQNLSYWRNPPYNTVRFFFTTIIALLLGTIFWDLGGKTYTSQDLMNAMGSMYSAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYALAQDILYGVIVYSMIGFEWTAAKFFWYLFFGYFTLLYFTFYGMMAVGLTPNYHIAAIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWICPVAWTLYGLVVSQF

Seg: seg
469-487 seg

FFWYLFFGYFTLLYFTFYG

Seg: seg
580-598 seg

VAAVVVAFAVLFATLFGFA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox