PRGDB00063999 (Zm.16645)

From PRG Wiki
Jump to: navigation, search
Zm.16645
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194690011 (BT034085)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0032F06 mRNA, complete cds

DNA Sequence

CCATTTGCGATTTCTTTCGAGGAAAAAGGGAAGCAAGCGCGGAAATACTCCACAGATACTACTCACCTACCGCTCCGATCCGGCCACCAAGCGCAACCAATATCTCGCTCCCTTTCTCTTTCTCCGTCTCCCTCCTCCGCACAGCGCACGCGCAGGAGGCCGCTGCCGGGAGGCCCATCTCTATCTCTCTCCGCTGGATCCTCCGGCCTCTCGCGGTCCGGTGGAGCGGAGATCCGGCCGCTCGGGCGTCGGCTGCTTCCTCGTTCTGCCGGAGCAAGAAGCTGGCATCCCGCCATGTCGTCACCGATGCCCTCCCCTACTCTGAAGGACCATCTCTCCACGCCTACAGGCCCCTTGCATCTCAAAGTATGGGAGGTCATATGCATTGCCTTGGGAGCTTTCATGGTGCTCGTCTTGTTTGCCACCGTGTGGCTCACGCTCAGGAGCAAGAAGAGGGTAAGGCGGCGGGCATCCGCAAATATCCCAATCACCCAAATCCCTGCAATTTCCAAGGAAATCAAGGAGGTGAGGGTGGAGCAAGTGCCGGCCAGCGACTTTGTGGCGCATGATGGCGTCCTCCTCACGTTCCAGGACAAGACCAGCGACCGGGATTCGGACAAGGTCATGGCCCATTTGGGTGTTAGCAAATCGAAGCGTGGTGATGAGAGCCATTCGGGGTCATTTCGCTACATGGACAAGGATGCAGGATTCCAGTCAGCTGAGGAAGGTGGCTCTGGAACGTTTCGGCAGACTTCAGCTAATGCCATAGTTGCTCCTTCACCTCTGGTTGGCCTGCCCGAGTTTTCATACCTTGGTTGGGGTCACTGGTTTACGCTGAGGGATCTGGAGCTTGCTACCAATCGCTTTTCAAAGGACAACATTATTGGTGAGGGTGGATACGGTGTAGTTTATCGCGGGCAGCTAATCAATGGCTCCCCTGTTGCTGTCAAAAAGCTTCTCAATAACCTAGGTCAAGCTGAGAAGGAATTTAGAGTAGAAGTTGAGGCTATTGGTCATGTTCGACACAAGAACTTGGTCCGGCTTCTTGGTTATTGCGTGGAGGGTACCCAAAGGATGCTTGTCTATGAGTATGTGAACAATGGAAACCTAGAACAATGGCTTCATGGAGCTATGAGTCAACATGGCTCTCTTACATGGGAGGCCCGCATAAAGATTCTTCTTGGGACTGCTAAAGCGCTTGCTTACTTGCATGAGGCGATTGAACCCAAAGTTGTGCACCGTGACATCAAATCCAGCAATATTTTGATTGATGATGAGTTCGAGTCCAAAGTATCAGATTTCGGTTTAGCCAAGCTTCTTGGCGCTGGAAAGAGTCATGTCACCACTAGAGTTATGGGTACCTTTGGGTATGTGGCACCAGAGTATGCAAATACTGGACTCTTGAACGAAAAGAGTGACATTTACAGCTTTGGAGTCGTTCTCCTTGAAGCAATTACCGGAAGGGATCCTGTTGACTATGGACGCCCACCAAACGAGGTGAATCTAGTTGACTGGCTAAAAATGATGGTTGCCAGCAGGCGGTCAGAAGAAGTAGTGGATCCCACCATAGAGACACGACCTTCGACGAGAGCTCTAAAGCGTGCACTTTTGACAGCTCTGAGGTGTGTGGATCCAGATTCAGAGAAGAGACCGAAGATGGGTCAAGTTGTCCGGATGCTGGAATCGGATGATCCAATTCCTCGAGGGGACAGAAGATCTAAGCACCACCGTGGAGGGAGCACAGAAATGGATTCGCAAAAGGACAACAACTCCGACACGGAGAAGAGTGATAATGCAGATTCGAAACCTAGCAGGACCAGAGCATCGTCGTCCAAATGAGCAAACCAGCATTTCACCTATTACAGTCTTCGGCACATTGCATGGACTGGGGGCTACGTCTATTTTACATTGCTGACGAATTGGTAACTGAAAGCTCTGAAGAAAGACCTAtttttcttttcttttcttttcttttctttttGTTGCAACAATTTATGATTTATTTGTAGAGAAGGTATTGGTTTTTGTACTTATCAATGTGTACGTACCGGTGCTCTTGACAATTGCTGCTGTAAGTTTTTAACATTGTGTACAGGCGTAGCATCATGAATACTGGCGGAATGCCCACAATATTTGAAATGATTATGTTTAAATGAAAGCCTCCTTCCCATTTGGGCCATT


Protein sequences

Name Description Sequence
Zm.16645 translated coding region predicted by ESTScan from UniGene Zm.16645

PFAISFEEKGKQARKYSTDTTHLPLRSGHQAQPISRSLSLSPSPSSAQRTRRRPLPGGPSLSLSAGSSGLSRSGGAEIRPLGRRLLPRSAGARSWHPAMSSPMPSPTLKDHLSTPTGPLHLKVWEVICIALGAFMVLVLFATVWLTLRSKKRVRRRASANIPITQIPAISKEIKEVRVEQVPASDFVAHDGVLLTFQDKTSDRDSDKVMAHLGVSKSKRGDESHSGSFRYMDKDAGFQSAEEGGSGTFRQTSANAIVAPSPLVGLPEFSYLGWGHWFTLRDLELATNRFSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPRGDRRSKHHRGGSTEMDSQKDNNSDTEKSDNADSKPSRTRASSSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF937
33-600 SUBFAMILY NOT NAMED

PISRSLSLSPSPSSAQRTRRRPLPGGPSLSLSAGSSGLSRSGGAEIRPLGRRLLPRSAGARSWHPAMSSPMPSPTLKDHLSTPTGPLHLKVWEVICIALGAFMVLVLFATVWLTLRSKKRVRRRASANIPITQIPAISKEIKEVRVEQVPASDFVAHDGVLLTFQDKTSDRDSDKVMAHLGVSKSKRGDESHSGSFRYMDKDAGFQSAEEGGSGTFRQTSANAIVAPSPLVGLPEFSYLGWGHWFTLRDLELATNRFSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPRGDRRSKHHRGGSTEMDSQKDNNSDTEKSDNAD

HMMPanther: PTHR24420
33-600 FAMILY NOT NAMED,FAMILY NOT NAMED

PISRSLSLSPSPSSAQRTRRRPLPGGPSLSLSAGSSGLSRSGGAEIRPLGRRLLPRSAGARSWHPAMSSPMPSPTLKDHLSTPTGPLHLKVWEVICIALGAFMVLVLFATVWLTLRSKKRVRRRASANIPITQIPAISKEIKEVRVEQVPASDFVAHDGVLLTFQDKTSDRDSDKVMAHLGVSKSKRGDESHSGSFRYMDKDAGFQSAEEGGSGTFRQTSANAIVAPSPLVGLPEFSYLGWGHWFTLRDLELATNRFSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPRGDRRSKHHRGGSTEMDSQKDNNSDTEKSDNAD

Seg: seg
35-46 seg

SRSLSLSPSPSS

Seg: seg
51-76 seg

RRRPLPGGPSLSLSAGSSGLSRSGGA

Seg: seg
148-159 seg

RSKKRVRRRASA

superfamily: SSF56112
IPR011009
259-568 Protein kinase-like (PK-like)
Protein kinase-like domain

PSPLVGLPEFSYLGWGHWFTLRDLELATNRFSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPR

Gene3D: G3DSA:3.30.200.20
276-351 no description

WFTLRDLELATNRFSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGY

ProfileScan: PS50011
IPR000719
289-553 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKM

HMMSmart: SM00219
IPR020635
289-560 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRML

HMMSmart: SM00220
IPR002290
289-560 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRML

HMMPfam: PF00069
IPR017442
291-557 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDNIIGEGGYGVVYRGQLINGSPVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVV

PatternScan: PS00107
IPR017441
295-318 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGYGVVYRGQLINGSPVAVKK

Gene3D: G3DSA:1.10.510.10
352-564 no description

CVEGTQRMLVYEYVNNGNLEQWLHGAMSQHGSLTWEARIKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDDEFESKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPPNEVNLVDWLKMMVASRRSEEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDD

PatternScan: PS00108
IPR008271
411-423 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKSSNILI

Seg: seg
529-541 seg

TRALKRALLTALR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox