PRGDB00064000 (Zm.16839)

From PRG Wiki
Jump to: navigation, search
Zm.16839
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223975914 (BT066269)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0150F02 mRNA, complete cds

DNA Sequence

GGCAACAGGCACATGGTTGGGCGGGCGGTTTGCCTTTTGCCCGTTTCTCACACACGCATTCTGAGTTTCTGACGAGACGACCAACACCACACGGAGAAGACGGAGGACAGTAGAGTCGTCGAAGCAGCTGTACGCCGGAAGGCCTACCCCCGCTATACTATCTGCCTTCCTACTCGCTTCCCTCCCCGAGTCCCCGTCCTCCTCAGCTGCCTTCCGCCGCCGTGCAGCACCCGCGCAGCCTCCACTCCGGCGTCGTCTCCCTCCCTCCTCCGCCATCGCCACCGGGACACGCAAAGCTTCCAGGTCTTGTCTTTGGGTAGAACATGTCGTGCTTTGCATGCTGTGGTGATGAAGATACACAAGTACCAGACACCAGGACTCAATACCCAGGACATCATCCAGCAAGAGCCGACGCATACCGCCCTGCTGATCAACCTCCCAAGGGTTCCCAACCTGTGAAAATGCAACCGATTGCAGTCCCTGCCATTCCTGTGGATGAGCTTAGGGAGGTGACTAAGGGTTTTGGTGATGAAGCCTTGATTGGTGAGGGCTCCTTTGGTAGAGTATACTTAGGTGTTCTAAGAAATGGCAGGAGTGCCGCGGTCAAAAAGTTGGATTCTAATAAGCAGCCAGACCAAGAATTCTTGGCGCAGGTGTCTATGGTGTCAAGGCTGAAGCACGAAAATGTTGTTGAGTTGCTTGGTTACTGTGCTGATGGGACACTCCGCGTCCTTGCCTACGAGTTTGCTACTATGGGTTCCCTTCATGATATGCTTCATGGAAGGAAAGGTGTTAAAGGGGCTCAACCCGGCCCGGTCTTATCATGGTTGCAGCGTGTGAAGATAGCTGTTGGGGCAGCAAAAGGCCTCGAGTATCTTCACGAGAAGGCGCAGCCTCATATCATGCACCGAGACATCAAGTCTAGCAACGTTCTTCTTTTCGATGACGACGTAGCTAAGATCGCTGACTTCGATTTGTCAAACCAAGCTCCGGACATGGCAGCCCGACTTCACTCGACTAGGGTTCTTGGAACGTTCGGATACCATGCGCCTGAGTATGCAATGACCGGGCAACTCAGCTCCAAGAGCGATGTATATAGTTTTGGAGTCGTTCTTCTCGAGCTATTGACCGGAAGGAAACCTGTGGACCATACATTACCAAGGGGACAGCAGAGTCTTGTGACTTGGGCTACCCCAAGACTTAGCGAAGACAAGGTTAGACAATGCGTTGACTCGAGGCTTGGAGGGGACTACCCTCCTAAAGCTGTTGCGAAGTTTGCAGCTGTTGCCGCGCTGTGTGTTCAGTACGAAGCGGACTTCCGGCCAAACATGAGCATTGTTGTCAAGGCGCTACAGCCCCTGCTGAATGCGCATGCGCGGGCGACCAACCCTTGAGAAAAATGCTAGCTCAAAAGCTTCGCATTGCTCCTCTCCGCCCTCTTGTATGATAGATAAGTAAGATACGAGTCGCCGATGTCGTTCTTGCGGACACATGGCTGGCAGCGTGTGACATTTGTGATTATTTGTCCCCTGAATTGTAAACAAGATTCTTGTATCCCCACAACACTTGATTCTTTCTATCGGTTGCAAGATGACCTGCCGTTTTCTTC


Protein sequences

Name Description Sequence
Zm.16839 translated coding region predicted by ESTScan from UniGene Zm.16839

XQQAHGWAGGLPFARFSHTHSEFLTRRPTPHGEDGGQXSRRSSCTPEGLPPLYYLPSYSLPSPSPRPPQLPSAAVQHPRSLHSGVVSLPPPPSPPGHAKLPGLVFGXNMSCFACCGDEDTQVPDTRTQYPGHHPARADAYRPADQPPKGSQPVKMQPIAVPAIPVDELREVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARATNP

Domains

Domain Start-End Description Sequence

Seg: seg
49-72 seg

LPPLYYLPSYSLPSPSPRPPQLPS

Seg: seg
80-97 seg

SLHSGVVSLPPPPSPPGH

superfamily: SSF56112
IPR011009
145-451 Protein kinase-like (PK-like)
Protein kinase-like domain

QPPKGSQPVKMQPIAVPAIPVDELREVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKAL

HMMPanther: PTHR24420:SF870
147-464 SUBFAMILY NOT NAMED

PKGSQPVKMQPIAVPAIPVDELREVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARATNP

HMMPanther: PTHR24420
147-464 FAMILY NOT NAMED,FAMILY NOT NAMED

PKGSQPVKMQPIAVPAIPVDELREVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARATNP

Gene3D: G3DSA:3.30.200.20
160-249 no description

VPAIPVDELREVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEF

ProfileScan: PS50011
IPR000719
175-455 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLL

HMMSmart: SM00219
IPR020635
175-451 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKAL

HMMSmart: SM00220
IPR002290
175-455 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
180-451 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHENVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
181-204 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSFGRVYLGVLRNGRSAAVKK

Gene3D: G3DSA:1.10.510.10
253-450 no description

GSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAKGLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKA

PatternScan: PS00108
IPR008271
301-313 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IMHRDIKSSNVLL

Seg: seg
421-431 seg

KAVAKFAAVAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox