PRGDB00064001 (Zm.17164)

From PRG Wiki
Jump to: navigation, search
Zm.17164
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 37778685 (AY188756)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays GCK-like kinase MIK mRNA, complete cds

DNA Sequence

ATGTCGGACTCGGCATCGATGGCGGCCGCCATCGAGGCGCGGTTCAGCAGCCGCGACCTCATCGGCTGCGGTTCCTTCGGCGACGTCTATAAAGGGTTTGACAAGGAACTGAATAAAGAGGTTGCTATAAAAGTCATTGATTTGGAAGAAGCTGAGGATGACATTGAAGACATCCAAAAGGAGATATCTGTTTTGTCACAATGCCGGTGCCCATATATTACCGATTATTACGGCTCTTATCTTCACCAGACTAAATTGTGGATAGTAATGGAATACATGGCTGGTGGTTCTGTTGCTGATCTTCTTCAAGCTGGTCCTCCTCTGGATGAAATGTCTATTGCATGCATTCTGAGGGACTTGTTACACGCAATTGAGTATCTACATTCCGAAGGAAAAATTCACCGTGATATTAAAGCGGCAAATATCCTCCTCACTGAAAGTGGAGATGTGAAGGTTGCGGACTTTGGTGTTTCTGCACAGCTGACTAAAACAATGTCTAGGAGAAAGACATTTGTTGGAACTCCCTTTTGGATGGCACCTGAGGTTATTCAAAATTCTGAAGGGTACAATGAGAAGGCAGATATCTGGTCTTTAGGTATCACTGCCATTGAAATGGCTAAAGGTGAACCCCCTCTGGCAGATATTCATCCCATGAGAGTTCTTTTCATCATACCTCGTGAAAATCCTCCGCAGCTTGATGAGCATTTCTCGAAACCAATGAAAGAGTTTGTCTCACTATGTTTAAAGAAGAATCCAGCAGAGAGGCCTAGTGCCAAGGAGCTTCTCAAGCATCGTTTCATAAAAAATGCCCGAAAGACTCCAAAGCTTTTGGAGCGAATAAGAGAGCGGCCAAAATTTGCAGCAAAAGGCATGGATGCCACACAAAATGGGCAAACACATGATGAAGAGGAGGATTTTGGTACAGGCACTATCAAGGTCAATAGGACAAAAGATACAGCTCCAGCTTTGAGTCAAGGAACAGTTAGGAAATCTGCAGTCAGAGATTTTTCTGATAGATCAGAGGGCACAGGAACTGTCCGAGTTGTTTCAAGGCCTCCTCAAATCGCCTCCACGAAGGATGGTAGATCTGATATGCCTAAAAGTCCAAAAGCACCAATACGCACAGCTGATCGAGAAAATCAGTGGAGGTCATCAGGGACTGGATCTGAAGAAtctctctctctcAGAGATACTCAGAGCGGACGAGGGAGAGTAGAAAGTTCTACTGATGACAATGATCACTCTGTAAGTGGGTCAGGAACTGTTGTGTTACGCTCTCCAAGAGCATCTCAGTTGTACTCAACAGCTAGCAACCACAGTGCCAAGCCTCCCAGCAGATTCTCCTCATATGAAGATATGTCTAATAGTGGGACAGTTGTTCAGACCCAAAATGAAGACCCGGAAACTCCACGATCTTCAAGGTCAAGGCTGGGGATCCAAGAAAAAGCATCAAATGCTCCTCTTGAGGATAGTGCCATTAACCTTGCAGAGGCAAAGGCTGCTTTGCAGGCTGGGTTAAGAAAGGGAAATGCTCGAGAAAGACCTTTTATCAACAGGCGTGAAAAGGGATCACATGAGCATAGATCTTCTGGAGTAAATAGTCAAGAGGTTCAAAGTGAGGATGTGGACACGCAGAAAGGTCACAAATTACGGCAATTACCTGATGGGCAGTCAGCCTCTCGTGCTAGTTCTGTAGCTTCACCTGCAGTCTCATCATTGCTACTCCCTTCCCTGAAAGAGGCTACTGGTGACAAGTTTGATCGGCCTGCTGTTCATGCCTTCCTTGATTCCTTGATGGATTTAGAACGTGATATACCTGGATCATGCGAAGTACTGGTTGGCAGATTGCTACACCGGCTAGGGAGCTCAAAGGATTCCTCATTGCAAGGTCTTCAGGAGACGGCGATGTCAATTTTCACTAAGGAACCTGAACCTCCCTCTGAAAAAGCAGGCGACAATAAGTTAGCTAATATGCCACCATTGGCTGCTCCTACCGTGAGCCCACTGGCAAGGTTCCTTCTCACAAGGTGGCAAAATCAAGTTTCTCAAGATCTTAACTCTGTTTGA


Protein sequences

Name Description Sequence
Zm.17164 translated coding region predicted by ESTScan from UniGene Zm.17164

MAAAIEARFSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFIKNARKTPKLLERIRERPKFAAKGMDATQNGQTHDEEEDFGTGTIKVNRTKDTAPALSQGTVRKSAVRDFSDRSEGTGTVRVVSRPPQIASTKDGRSDMPKSPKAPIRTADRENQWRSSGTGSEESLSLRDTQSGRGRVESSTDDNDHSVSGSGTVVLRSPRASQLYSTASNHSAKPPSRFSSYEDMSNSGTVVQTQNEDPETPRSSRSRLGIQEKASNAPLEDSAINLAEAKAALQAGLRKGNARERPFINRREKGSHEHRSSGVNSQEVQSEDVDTQKGHKLRQLPDGQSASRASSVASPAVSSLLLPSLKEATGDKFDRPAVHAFLDSLMDLERDIPGSCEVLVGRLLHRLGSSKDSSLQGLQETAMSIFTKEPEPPSEKAGDNKLANMPPLAAPTVSPLARFLLTRWQNQVSQDLNSV

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
4-86 no description

AIEARFSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEY

HMMPanther: PTHR24361:SF186
5-673 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PAK 1

IEARFSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFIKNARKTPKLLERIRERPKFAAKGMDATQNGQTHDEEEDFGTGTIKVNRTKDTAPALSQGTVRKSAVRDFSDRSEGTGTVRVVSRPPQIASTKDGRSDMPKSPKAPIRTADRENQWRSSGTGSEESLSLRDTQSGRGRVESSTDDNDHSVSGSGTVVLRSPRASQLYSTASNHSAKPPSRFSSYEDMSNSGTVVQTQNEDPETPRSSRSRLGIQEKASNAPLEDSAINLAEAKAALQAGLRKGNARERPFINRREKGSHEHRSSGVNSQEVQSEDVDTQKGHKLRQLPDGQSASRASSVASPAVSSLLLPSLKEATGDKFDRPAVHAFLDSLMDLERDIPGSCEVLVGRLLHRLGSSKDSSLQGLQETAMSIFTKEPEPPSEKAGDNKLANMPPLAAPTVSPLARFLLTRWQN

HMMPanther: PTHR24361
5-673 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

IEARFSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFIKNARKTPKLLERIRERPKFAAKGMDATQNGQTHDEEEDFGTGTIKVNRTKDTAPALSQGTVRKSAVRDFSDRSEGTGTVRVVSRPPQIASTKDGRSDMPKSPKAPIRTADRENQWRSSGTGSEESLSLRDTQSGRGRVESSTDDNDHSVSGSGTVVLRSPRASQLYSTASNHSAKPPSRFSSYEDMSNSGTVVQTQNEDPETPRSSRSRLGIQEKASNAPLEDSAINLAEAKAALQAGLRKGNARERPFINRREKGSHEHRSSGVNSQEVQSEDVDTQKGHKLRQLPDGQSASRASSVASPAVSSLLLPSLKEATGDKFDRPAVHAFLDSLMDLERDIPGSCEVLVGRLLHRLGSSKDSSLQGLQETAMSIFTKEPEPPSEKAGDNKLANMPPLAAPTVSPLARFLLTRWQN

superfamily: SSF56112
IPR011009
8-292 Protein kinase-like (PK-like)
Protein kinase-like domain

RFSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFIKNARKTPKLLERIRERPKFAAKGMDATQNGQ

ProfileScan: PS50011
IPR000719
9-261 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFI

HMMSmart: SM00220
IPR002290
9-261 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFI

HMMSmart: SM00219
IPR020635
9-260 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSRDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRF

HMMPfam: PF00069
IPR017442
13-261 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQCRCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFI

PatternScan: PS00107
IPR017441
15-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGSFGDVYKGFDKELNKEVAIK

Coil: coil
35-63 coiled-coil

VAIKVIDLEEAEDDIEDIQKEISVLSQCR

Seg: seg
40-56 seg

IDLEEAEDDIEDIQKEI

Gene3D: G3DSA:1.10.510.10
89-297 no description

GGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKTMSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADIHPMRVLFIIPRENPPQLDEHFSKPMKEFVSLCLKKNPAERPSAKELLKHRFIKNARKTPKLLERIRERPKFAAKGMDATQNGQTHDEE

Seg: seg
377-390 seg

RSSGTGSEESLSLR

Seg: seg
552-572 seg

SASRASSVASPAVSSLLLPSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox