PRGDB00064002 (Zm.17418)

From PRG Wiki
Jump to: navigation, search
Zm.17418
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223944934 (BT061854)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0189C01 mRNA, complete cds

DNA Sequence

CGTGAGGCCTTCCACCCAGCTCAAGCCCACAGCATCCACTGACACTGCCACCGCCGCTCACCTCCCCGGCGTTCCCGGCTCCACCAACTACTGCAAGCATGAGGCAGCCCACCAGCGCGGGCGGCGACGCTGGGTTCGTGCGCGCGGACCAGATCGACCTCAAGAGCCTGGACGAGCAGCTCGAGCGCCACCTCGGACGCCGGGCGGAGCGGGGAGTCGGCCTACCCTCCGGGACGGGGAGCCGCGGCGGCGAGTCCGCGAGGCTGGGCCCGGAGGAGCTGACGCCGCTGCGGCGGTGCCGTGAAGACTGGGAGATCGACCCCACCAAGCTCGTTATCAAGGGCGTCATCGCGCGCGGCACCTTTGGCACCGTCCACCGCGGCGTCTACGACGGCCAGGACGTCGCTGTAAAATTGCTTGACTGGGGTGAGGATGGTCATAGATCAGAACAAGAAATTGCTGCACTGCGAGCAGCTTTTGCACAAGAAGTTGTTGTCTGGCATAAGCTTGAACATCCGAACGTTACTAAGTTTATTGGTGCTATAATGGGTGCAAGAGATTTAAATATACAGACAGAACATGGACATCTTGGCATGCCCAGTAATATTTGCTGCGTTGTTGTTGAGTACCTCCCTGGAGGTGCACTGAAAAGTTTTCTGATAAAGAACAGGAGAAGGAAGCTTGCCTTTAAAGTTGTGGTCCAAATAGCTCTTGACATTGCCAGGGGATTATGCTATCTCCACTCAGAGAAGATAGTGCATCGTGATGTCAAGACTGAAAATATGCTTCTGGACAAAACGAGAACTGTAAAAATTGCTGATTTTGGTGTTGCCCGAGTTGAGGCTTCAAACCCTAGCGATATGACGGGCGAAACAGGGACACTTGGTTACATGGCTCCAGAGGTTCTCAACGGCCATGCTTACAACAGGAAGTGTGACGTGTACAGCTTTGGGATCTGCCTGTGGGAGGTATACTGCTGTGACATGCCGTACCCCGACCTTAGCTTTTCTGAAGTCACCTCTGCCGTGGTTCGCCAGAACCTGAGGCCTGAGATACCGCGCTGCTGCCCGAGCTCGCTAGCGAACGTGATGAAGCGATGCTGGGACGCGAACCCGGACAAGCGTCCCGAGATGGCGGAGGTGGTGTCCATGCTGGAGGTGATCGACACGTCCAAGGGTGGCGGCATGATCCCCAAGGACCAGACGCAGGGCTGGCTCTCGTGTTTCCGCCGGTACCGAGGCCCCTAACGCAGAGTTGCTTTTACCCGGCGAAATGATGATATTGGTCTCCACGACTCAGTGTAATCTAATCGCAGAACTGGCTATAATTGAGAGTTTTCTCGTTGTCCTGGGCGTAAATGCATGGATGGGCCGGCAGTTGACGATTGATGTCCGTTCAAATGCTTGCTGTAAGTTAATTCAGGTGTAGAGGGAGTTGCTGTGGCCGTTTGCT


Protein sequences

Name Description Sequence
Zm.17418 translated coding region predicted by ESTScan from UniGene Zm.17418

XVRPSTQLKPTASTDTATAAHLPGVPGSTNYCKHEAAHQRGRRRWVRARGPDRPQEPGRAARAPPRTPGGAGSRPTLRDGEPRRRVREAGPGGADAAAAVPEDWEIDPTKLVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVIDTSKGGGMIPKDQTQAGSRVSAGTEAPNAELLLPGEMMILVSTTQCNLIAELAIIESFLVVLGVNAWMGRQLTIDVRSNACCKLIQVXRELLWPFA

Domains

Domain Start-End Description Sequence

Seg: seg
40-54 seg

RGRRRWVRARGPDRP

Seg: seg
57-76 seg

PGRAARAPPRTPGGAGSRPT

superfamily: SSF56112
IPR011009
73-389 Protein kinase-like (PK-like)
Protein kinase-like domain

SRPTLRDGEPRRRVREAGPGGADAAAAVPEDWEIDPTKLVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVID

Seg: seg
89-99 seg

AGPGGADAAAA

Gene3D: G3DSA:3.30.200.20
100-180 no description

VPEDWEIDPTKLVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIG

HMMPanther: PTHR23257
102-403 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EDWEIDPTKLVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVIDTSKGGGMIPKDQTQ

HMMPanther: PTHR23257:SF276
102-403 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EDWEIDPTKLVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVIDTSKGGGMIPKDQTQ

ProfileScan: PS50011
IPR000719
111-388 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVI

HMMSmart: SM00220
IPR002290
111-388 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEVI

HMMSmart: SM00219
IPR020635
111-385 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LVIKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSML

HMMPfam: PF07714
IPR001245
113-385 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IKGVIARGTFGTVHRGVYDGQDVAVKLLDWGEDGHRSEQEIAALRAAFAQEVVVWHKLEHPNVTKFIGAIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSML

Gene3D: G3DSA:1.10.510.10
181-387 no description

AIMGARDLNIQTEHGHLGMPSNICCVVVEYLPGGALKSFLIKNRRRKLAFKVVVQIALDIARGLCYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPEVLNGHAYNRKCDVYSFGICLWEVYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEV

FPrintScan: PR00109
IPR001245
208-221 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VEYLPGGALKSFLI

FPrintScan: PR00109
IPR001245
246-264 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHSEKIVHRDVKTENMLL

PatternScan: PS00108
IPR008271
252-264 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKTENMLL

FPrintScan: PR00109
IPR001245
312-334 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDVYSFGICLWEVYCCDMPYPDL

FPrintScan: PR00109
IPR001245
356-378 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CPSSLANVMKRCWDANPDKRPEM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox