PRGDB00064003 (Zm.17462)

From PRG Wiki
Jump to: navigation, search
Zm.17462
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78116748 (DV535135)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFb0227A11.r ZM_BFb Zea mays cDNA 5', mRNA sequence

DNA Sequence

GGGAACATTCGGCTATGTTGCGCCAGAGTACGCCATGACGGGTCATCTTCTTGTAAAGAGTGATGTGTACAGTTACGGAGTTGTATTGCTTGAGCTCCTCACTGGTAGGAAACCTGTGGATATGTCACGGCCTGCCGGGCAAGAAAACCTAGTTGCATGGGCTCGACCGCTTCTAACAAATGTTCTGAGCCTACGCCAAGCTGTCGATCCACTTCTTGGACCTAACGTTCCACTGGACAATGTAGCAAAAGCAGCTGCCATCGCATCAATGTGCGTACAACCTGAGGTTGCTCACCGCCCCAGCATGGGTGAAGTAGTGCAGGCCTTGAAGCTTGTGTGCAGCGAGGGTGACGACGGCATTGCGTCAGGAAGATTCAGCCAGGAGTTGCCCATGCAAACTACAGCGGTTTATGACGCGACTGGCATGGAAGCTGAGAGAGTGCTAATATCCGACATATTTGGCTCCACACCACTCTTTACTCGAGGTGCCGATTCAGATTCTTTTCGCAAGCAGTCAAGTTCAGGCCCGCTGATGACAGGCAAGAACAGGAAGTTCTGGCAGAGGTTACGAAGCCTGTCAAGAGGGAGCATGAGTGAGCATGGCATCTCACCAGACTATGAAACCCGCTCGCAATACAGTGGTAGGTGAGGAAACCTTTGCTTGGCTTCGATTAGAAAACGGATTGATACTCAGACTGGGAATAAAAGAGTTCAAGCTGAGCTAGTGTAAACTACGCATCTGGAGGTGAAAGCTATAGCTTCAGGATCTCATTCAGAGTAGCAGAGTGGAGCCTGAGCTTTGGATTGCTGGAATGGAAATAACATCTGCTGTGGACTGCTGGGATCTACCTGCAAAACTACGTGGCCATACTCCAGAACCTTATACCCCCACTTCCTTTTAGAGGTTTGTAATTTGAGAATT


Protein sequences

Name Description Sequence
Zm.17462 translated coding region predicted by ESTScan from UniGene Zm.17462

XGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALKLVCSEGDDGIASGRFSQELPMQTTAVYDATGMEAERVLISDIFGSTPLFTRGADSDSFRKQSSSGPLMTGKNRKFWQRLRSLSRGSMSEHGISPDYETRSQYSGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-113 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALKLV

Gene3D: G3DSA:1.10.510.10
2-111 no description

GTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALK

superfamily: SSF56112
IPR011009
2-110 Protein kinase-like (PK-like)
Protein kinase-like domain

GTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQAL

HMMPanther: PTHR24420:SF801
2-164 SUBFAMILY NOT NAMED

GTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALKLVCSEGDDGIASGRFSQELPMQTTAVYDATGMEAERVLISDIFGSTPLFTRGA

HMMPanther: PTHR24420
2-164 FAMILY NOT NAMED,FAMILY NOT NAMED

GTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALKLVCSEGDDGIASGRFSQELPMQTTAVYDATGMEAERVLISDIFGSTPLFTRGA

HMMPfam: PF07714
IPR001245
6-110 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

YVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPAGQENLVAWARPLLTNVLSLRQAVDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox