PRGDB00064006 (Zm.18004)

From PRG Wiki
Jump to: navigation, search
Zm.18004
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195640191 (EU967446)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 303165 dihydroflavonol-4-reductase mRNA, complete cds

DNA Sequence

ACGGGAAAGGAGTACGGAGTACCGGAGACATCGTCAACGCCATGGCCGGAGGAGGTGCAACGGTGTGCGTGACCGGAGCCGGCGGGTTCATCGCCTCGTGGGTAGTGAAGCTCCTGCTCTCCCGCGGGTACACCGTGCACGGCACCGTCCGCCACCTCAGTGACGAGAAGACAGGCCACCTGAAGCGCCTGGAGAATGCTGCCGGAAACCTTAGGATCTTCAAGGCTGACCTGCTGGACTACGACGCCATGGCAGCTGCGGTCGTCGGGTGCCAGGGGGTTTTCCATGTGGCCACTCCTGTGCCTTCGGAGGACCTGACTGACCCAGAGCTACAAATGCTGGGTCCTGCTGTTACCGGCACCACGAATGTGCTCAAAGCTGCCTCCAGCGCGAACGTCCAGCGAGTGGTGGTGGTGTCGTCCATGGTTGCCGTCGAGATCAGCCCCAAAGATTGGCCTGAAGGTAAGGTCCGAGATGAGAGGTGCTGGTCAGACCGAGAGTTCTGCAGGAGCATTGAGAGCTGGTACCCGGTGGCTAAGATCATCTCAGAGGAGGCGGCGCTGGCGTACGGGCAGCAAACCGGGCTCGACGTGGTGACTATCAATCCAGGGTTGGTGTTCGGCCCCATGCTGCAGCCGACGGTCAACACGACCATCCAGTTCCTCATCTACTTCCTCAAAGGAGGCCCCGACCCGGTGAAGAACAAGCTCTGGCACATCGTCGACGTCCGCGATGTGGCCGACGCCATGCTGCTGCTCTACGAGGTGCCTGAAGCGACCGGCAGACACATCTGCGCGCCTCATGTTATCAGTGCCCGCGACCTGCTGGATCTGCTGAAGAGCATGTACCCTGACTACCCTTGCATTGCCAACGAGAGCATACTTGACAGAGACCACCCAGCGCCGATGACCTCTGACAAGCTGAAGAAGATCGGGTGGAGCTGCCGACCGCTGGAGGAGACGATCGTGGACACCGTCGAGTGCTGCCTGCGGGCTGGATTTCTGGACGACGTGGGTGGGGAGACTTCCTGTCGCTTCCCTCCTCTTTTAAACCAGATCTAGCCTCGGCGAAAGCATGAATTGTGRTTGCCTATGCTCTTGCTTATGTTACCGTGGACGACGAGCGTCAGCTTTTAAATAAACGTCATTGCATGCTGTTGTATTTCTTATATTACTGTGGACAAGCATCGATCAGAGCTTTTAAATTGTTAGGATCACAGGTGAAAAAGGAGACAGAGTTTAACGTGGAAAAAACTCTCTAATTTGGAGGAGAAAAAATCACGGGAAAACAGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaammcaaaaaaaaaaaaaaaaR


Protein sequences

Name Description Sequence
Zm.18004 translated coding region predicted by ESTScan from UniGene Zm.18004

XGKGVRSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVECCLRAGFLDDVGGETSCRFPPLLNQI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF74
5-338 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VRSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVECCLRAGFLDDV

HMMPanther: PTHR10366
5-338 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VRSTGDIVNAMAGGGATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVECCLRAGFLDDV

Seg: seg
16-29 seg

AGGGATVCVTGAGG

superfamily: SSF51735
19-331 NAD(P)-binding Rossmann-fold domains

GATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMYPDYPCIANESILDRDHPAPMTSDKLKKIGWSCRPLEETIVDTVECCLR

Gene3D: G3DSA:3.40.50.720
IPR016040
20-283 no description
NAD(P)-binding domain

ATVCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHICAPHVISARDLLDLLKSMY

HMMPfam: PF01370
IPR001509
22-264 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIASWVVKLLLSRGYTVHGTVRHLSDEKTGHLKRLENAAGNLRIFKADLLDYDAMAAAVVGCQGVFHVATPVPSEDLTDPELQMLGPAVTGTTNVLKAASSANVQRVVVVSSMVAVEISPKDWPEGKVRDERCWSDREFCRSIESWYPVAKIISEEAALAYGQQTGLDVVTINPGLVFGPMLQPTVNTTIQFLIYFLKGGPDPVKNKLWHIVDVRDVADAMLLLYEVPEATGRHI

Seg: seg
76-87 seg

ADLLDYDAMAAA

Seg: seg
127-145 seg

AASSANVQRVVVVSSMVAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox