PRGDB00064007 (Zm.18038)

From PRG Wiki
Jump to: navigation, search
Zm.18038
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224033072 (BT068715)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0376I03 mRNA, complete cds

DNA Sequence

CCGAACGAAAGGAAGgagagagagagagagagagagaaaaaaaaaGGACGGCTCCGCCCAAGGGTCGGAAGGGAGGGAGTTGCCGCGCCGCGGCCGGTTCGATCCTTTGCGCGAGATCGAGCTTCTCCGGTTGGTGTTGGGGCTGGCGACATCTGGGATCCGTCGTCTCTCCTCGTGTTCTTGAGCAGTTTTCCACTTGCCTGGCAAAAGAACATTTGACTTGGAAGAGCAAACACTGGAAGCTTTGTGGTTTGTCCTAAGTGATCCTATCAAGTTCTCATAGGCTGCATACTGGTACAGCATTTTCTCCTGTGTTTTGGGCCACAGAAGAGGGGGGAGCCAAGGATTTTTCTATCTCGTAAGCCGCGGCCTTGGTGCTCATAGTTACCCTAGTCTGTAAGCTGGAGATTGTAAAAAGCCATATCTGTTCCTCTATCACTGTATATAGAGATCTACATAATGGACGAGAGGAGGACTATTTTGATGGACCGTTACGAAATCGGGAGGCAGTTAGGCCAAGGAAACTTCGCCAAGGTATACTTTGCTCGGAACCTGACCGACGGGCAGTCCGTTGCGATAAAGATGATCGATAAGGACAAGATCACGAGGGTTGGGCTAATAGTGCAGATAAAGAGGGAGATCTCTATAATGAGGCTGGTGAAGCATCCGAATGTCCTGCAGCTCTTCGAGGTAATGGCTAGCAAGAGCAAGATCTACTTCGTATTGGAGTACGCTAAAGGCGGCGAGCTGTTCAACAAAGTATCAAAGGCGAAGCTCAGCGAGGATGCCGCGAGGAGGTATTTCCACCAGCTGGTTAATGCCGTGGACTACTGCCACAGCCGAGGCGTCTACCATCGCGACTTGAAGCCGGAAAACCTACTCCTGGACGAGAACGAGAACCTTAGAGTCTCGGACTTCGGTCTGAGCGCCCTGTCTGAATCCAGAAGGCACGACGGCCTCCTACATACCACGTGTGGAACCCCTGCCTATGTTGCTCCTGAAGTGCTTGGTAGGAGAGGCTACGATGGCACCAAGGCGGACATATGGTCCTGCGGAGTGATTCTCTTCGTGCTCGTGGCTGGTTACCTGCCGTTCCACGACCCGAATCTCATCGAGATGTACAGGAAGATCTCCAGAGCTGAATACAGATGCCCTCGCTCCTTCTCCGGTGAGCTGAAGGACCTGCTTTTCAGAATGCTCGATCCAGATCCCAGTACCAGGATATCCATTTCAAGGATCAAGAGAAGCACTTGGTACAGAAAACCTATCGAGGCAAACGCGGCAAAGATCAAGCACGGCACAGCAAGAGACACCACCGTGCGCGACGGTGAAGCCGCCACGGCCTCGAGCTCGATAGAGTGCAGTAACCGGCCAGAGGAAGACCAAGGGTCGTCAAGCCTCCCTAACCTGAACGCATTCGACATCATTTCTCTCTCGACCGGGTTTGACCTATCTAACCTGTTCGAAGAAAGACACGGGCGGAGGGAGGAGAGGTTCACCACCAGGCAGCCAGTGGGAGCGGTGTTTGGTAGGCTGAAGGAGCTGGCTGAGCGGTTGAAGCTGAAAATCCAGAAGAAGGAGAGCGGGGTCTTGAAACTGGCTGCGCAGAAGGAAGGGATGAAGGGGTTCCTGGAGCTCGACGCCGAGGTTTTCGAGCTTGCCCCTTCGTTCCTTCTGGTCGAGCTGAAGAAGGCCAGCGGTGACACCATTGAGTACCAAAGGCTCGTGAGGGAAGAAGTGCGGCCTGCGCTGAAGGATATGGTCTGGGCTTGGCAGAGCGACCGGCACcagcagcagcagcagcGGTGCGAGCAGTCTGTGCAAGGAGAGGACCAGCAGCAGCCGTTGTCGTCTTTGCCGACGCAGCAGTAGTCACTGCACCACCAGTTGCGACCGCCATAACCAGATCACGTCAAAACTGCACCAAGCCGCACAGGACTAGTAACTCCCACTTGCATCGACGCTTATGTGATTGCGGAATTGTGTTTCAGGTTACCTGCCTGCTGCGGTAGGACCTAAAACGCCTACCTGCCTACCATTTGGCATTTTTTTGTATACTGTACGTACATTAGAGTAATAAACAAACATGCTTAACTTTTCAGCTTTC


Protein sequences

Name Description Sequence
Zm.18038 translated coding region predicted by ESTScan from UniGene Zm.18038

MDERRTILMDRYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWYRKPIEANAAKIKHGTARDTTVRDGEAATASSSIECSNRPEEDQGSSSLPNLNAFDIISLSTGFDLSNLFEERHGRREERFTTRQPVGAVFGRLKELAERLKLKIQKKESGVLKLAAQKEGMKGFLELDAEVFELAPSFLLVELKKASGDTIEYQRLVREEVRPALKDMVWAWQSDRHQQQQQRCEQSVQGEDQQQPLSSLPTQQXSLHHQLRPPXPDHVKTAPSRTGLVTPTCIDAYVIAELCFRLPACCGRT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24346
2-268 FAMILY NOT NAMED,MAP/MICROTUBULE AFFINITY-REGULATING KINASE

DERRTILMDRYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWYRK

HMMPanther: PTHR24346:SF45
2-268 CBL-INTERACTING PROTEIN KINASE 26

DERRTILMDRYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWYRK

Gene3D: G3DSA:3.30.200.20
7-108 no description

ILMDRYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSE

superfamily: SSF56112
IPR011009
7-483 Protein kinase-like (PK-like)
Protein kinase-like domain

ILMDRYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWYRKPIEANAAKIKHGTARDTTVRDGEAATASSSIECSNRPEEDQGSSSLPNLNAFDIISLSTGFDLSNLFEERHGRREERFTTRQPVGAVFGRLKELAERLKLKIQKKESGVLKLAAQKEGMKGFLELDAEVFELAPSFLLVELKKASGDTIEYQRLVREEVRPALKDMVWAWQSDRHQQQQQRCEQSVQGEDQQQPLSSLPTQQXSLHHQLRPPXPD

HMMPfam: PF00069
IPR017442
12-265 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTW

ProfileScan: PS50011
IPR000719
12-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWY

HMMSmart: SM00219
IPR020635
12-265 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTW

HMMSmart: SM00220
IPR002290
12-266 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGELFNKVSKAKLSEDAARRYFHQLVNAVDYCHSRGVYHRDLKPENLLLDENENLRVSDFGLSALSESRRHDGLLHTTCGTPAYVAPEVLGRRGYDGTKADIWSCGVILFVLVAGYLPFHDPNLIEMYRKISRAEYRCPRSFSGELKDLLFRMLDPDPSTRISISRIKRSTWY

PatternScan: PS00107
IPR017441
18-41 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGNFAKVYFARNLTDGQSVAIK

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

Seg: seg
138-148 seg

ENLLLDENENL

Seg: seg
254-263 seg

RISISRIKRS

ProfileScan: PS50816
IPR018451
312-336 NAF
NAF/FISL domain

SSLPNLNAFDIISLSTGFDLSNLFE

HMMPfam: PF03822
IPR004041
315-372 NAF
NAF domain

PNLNAFDIISLSTGFDLSNLFEERHGRREERFTTRQPVGAVFGRLKELAERLKLKIQK

Seg: seg
336-345 seg

EERHGRREER

Seg: seg
358-369 seg

RLKELAERLKLK

Gene3D: G3DSA:1.10.510.10
432-433 no description

KD

Seg: seg
439-455 seg

QSDRHQQQQQRCEQSVQ

Seg: seg
459-477 seg

QQQPLSSLPTQQXSLHHQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox