PRGDB00064008 (Zm.18052)

From PRG Wiki
Jump to: navigation, search
Zm.18052
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194694397 (BT036278)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0104K17 mRNA, complete cds

DNA Sequence

GTCCGTCGGTCGTGATCGGTACCAATGGAAGGCGCAGCGGGGATCAGGACGAGGCCGGCGGTGTGCGTGACCGGCGCGGGCGGCTTCGTGGCCTCGTGGCTCGTCGAGCGCCTCCTCGCCGGCGGCCGATACATGGTCCATGGCACCGTCCGTGATCCGGGCGACGCCAAGAACGCGCACCTGGCGGCGATGGACGGCGCCGCGGACCGGCTGCGCCTGTTCAGGGCCGAATTGCTCGACTACGGCAGCGTGGCGGCGGCCATCGCCGGCTGCGACGGCGTCTTCCACGTCGCGTCCCCAGTCCCCATGACCTATCCAATCGGTGACCCCGAGGTAGAGCTGCTCGCTCCGGCCGTGACGGGCACCAAGAACGTCCTGAAGGCGTGCTCGGAGGCCAAGGTGAAGAGGGTCGTCGTGGTGTCGTCGGTGGCCGCCGTGATGGTGAACCCTGGCTGGCCCCAGAACGAGGCCATGGACGAGGCTTGTTGGTCCGACGTCGAATTCTGCAGAACCACTCAGAACTGGTACTGTCTCTCCAAGACACTCGCGGAGCTGGAAGCGCTTGATTACGCAAAGAGGAGTGGACTAGACGTGGTGTCCGTCTGCCCGTCGCTGGTGATCGGGCCCTTGCTGCAGTCGACGGTGAACGCAAGCAGCTCCGTCATAGTCGATTGCTTGAAAGGAGATCGTGAGGTGAAGCTGAAGCTGAGGAACTTCGTGGACGTCCGCGACGTCGCCGACGCTCTGCTCCTGGTGTACGAGACTCCGGAGGCGTCTGGACGGTACATCTGCGACGCAAATGCAAGGCAGATGTCTGAGGTCGTAGCGCTGCTCAAGGACTGGTACCCTGCCTACAGTCATGCTGCCACCAAGTAAGCAGAAACATACTGCAGAAGCTATATGCTTGTGTTGTGTTAGTCAAGCTATCAGTGCTTGATGAATCGCAAGCTGCTAGTGCATAGTAGGTTGCATTGTGATCAAGGGCAAAGTGCATGGCACAGGTTCGTGCAGGTGAGCGATGAGCCTTTGTTCAGCTCCAAGAAGCTGCAGGCGCTGGGCTGGAAATTCCGGACTCTGGAGGAGAGCCTCAGGGACAGCGTTGAATCCTTCAAGGCGGCAGGTGTCCTGGTGGATTGAACAGAACAGGCAGCGCCCTATTCCTGGATGACCTTCGCATTTTGTAAACCGAAGTTGCTGTCTTGTGCAAGAGCATCCCGACGTCCTCGGATAATGTAATaaaaaaagcaaaaGCGACAAAGTTTGCCGTGTATTATAGCGGCATTGTT


Protein sequences

Name Description Sequence
Zm.18052 translated coding region predicted by ESTScan from UniGene Zm.18052

MEGAAGIRTRPAVCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDVADALLLVYETPEASGRYICDANARQMSEVVALLKDWYPAYSHAATKXAETYCRSYMLVLCXSSYQCLMNRKLLVHSRLHCDQGQSAWHRFVQVSDEPLFSSKKLQALGWKFRTLEESLRDSVESFKAAGVLVD

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
11-364 NAD(P)-binding Rossmann-fold domains

PAVCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDVADALLLVYETPEASGRYICDANARQMSEVVALLKDWYPAYSHAATKXAETYCRSYMLVLCXSSYQCLMNRKLLVHSRLHCDQGQSAWHRFVQVSDEPLFSSKKLQALGWKFRTLEESLRDSVESFKA

Gene3D: G3DSA:3.40.50.720
IPR016040
13-237 no description
NAD(P)-binding domain

VCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDV

HMMPfam: PF01370
IPR001509
13-254 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDVADALLLVYETPEASGRY

HMMPanther: PTHR10366:SF74
13-368 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDVADALLLVYETPEASGRYICDANARQMSEVVALLKDWYPAYSHAATKXAETYCRSYMLVLCXSSYQCLMNRKLLVHSRLHCDQGQSAWHRFVQVSDEPLFSSKKLQALGWKFRTLEESLRDSVESFKAAGVL

HMMPanther: PTHR10366
13-368 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VCVTGAGGFVASWLVERLLAGGRYMVHGTVRDPGDAKNAHLAAMDGAADRLRLFRAELLDYGSVAAAIAGCDGVFHVASPVPMTYPIGDPEVELLAPAVTGTKNVLKACSEAKVKRVVVVSSVAAVMVNPGWPQNEAMDEACWSDVEFCRTTQNWYCLSKTLAELEALDYAKRSGLDVVSVCPSLVIGPLLQSTVNASSSVIVDCLKGDREVKLKLRNFVDVRDVADALLLVYETPEASGRYICDANARQMSEVVALLKDWYPAYSHAATKXAETYCRSYMLVLCXSSYQCLMNRKLLVHSRLHCDQGQSAWHRFVQVSDEPLFSSKKLQALGWKFRTLEESLRDSVESFKAAGVL

Seg: seg
124-140 seg

AKVKRVVVVSSVAAVMV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox