PRGDB00064009 (Zm.18140)

From PRG Wiki
Jump to: navigation, search
Zm.18140
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84980861 (DW531210)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

ZMEC_11F06 ZmEC Zea mays cDNA, mRNA sequence

DNA Sequence

CACAAACCTCACCACAGCAGGCATTTGCTACACACTCGTTGCTCGTCTCCCTCCTCATCCTCAGATCACATTGCCAGACGCCATGGAAGTCACAGGCACGAGGAGAGCCTTGCCGATCGCCGCATTCGCCCTCTTGGCGATGGCTCTGGCGTCCCTGGAGCCGGTGCTGGCAAGCAGGGACGGCGACGCGCTGACGGCGCTACGCAAGGGCATCGAGGACCCCGACGGCGCGCTCACGGATTGGGACCCGAACCTGGTGGACCCGTGCACGTGGTTTCACGTCGTGTGTGACGGCGACAACCGCGTCATCCGCCTGGATCTTGGGAGACTGAACCTGTCGGGTCCTCTGGCACCCGAGCTGGGACAACTGGATCAGCTGCAATACATGGAAATTTTCGGGAACAGCATCAGTGGACCAATTCCATCAGAGTTCGGTAGCCTGGCGAACCTGATCAGCCTGGACCTGTCCAGCAACAGCATCTCAGGAGCTATACCCGCAGCGCTCGGGAACGCCAAGTCCCTGAAGTTCCTGCGTTTGGATCACAATCGCCTGACGGGGCCGATCCCAAGGGAGCTTGCTGGGCTGCCCAATCTTGGAATTGTAGATTTCTCCAACAACGACCTTTGTGGCGCGATCCCGACAGACGGAGCATTCCAGAACATTCCCCGTAGCAGCTTCGACAACAACCCGCGGCTGCATGAGGGAGGCGAGTTTGAACCCAACTGCTAGATGGCTGTCTGTAACTCTGTATGAATAATGATCGAACAATCACGTAGAGCGGTGTTCTGATCCATCCATGCAGACTTTCTCA


Protein sequences

Name Description Sequence
Zm.18140 translated coding region predicted by ESTScan from UniGene Zm.18140

XTNLTTAGICYTLVARLPPHPQITLPDAMEVTGTRRALPIAAFALLAMALASLEPVLASRDGDALTALRKGIEDPDGALTDWDPNLVDPCTWFHVVCDGDNRVIRLDLGRLNLSGPLAPELGQLDQLQYMEIFGNSISGPIPSEFGSLANLISLDLSSNSISGAIPAALGNAKSLKFLRLDHNRLTGPIPRELAGLPNLGIVDFSNNDLCGAIPTDGAFQNIPRSSFDNNPRLHEGGEFEPNCXMAVCNSV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
36-223 FAMILY NOT NAMED,FAMILY NOT NAMED

RALPIAAFALLAMALASLEPVLASRDGDALTALRKGIEDPDGALTDWDPNLVDPCTWFHVVCDGDNRVIRLDLGRLNLSGPLAPELGQLDQLQYMEIFGNSISGPIPSEFGSLANLISLDLSSNSISGAIPAALGNAKSLKFLRLDHNRLTGPIPRELAGLPNLGIVDFSNNDLCGAIPTDGAFQNIP

Seg: seg
37-53 seg

ALPIAAFALLAMALASL

superfamily: SSF52058
55-224 L domain-like,LRR

PVLASRDGDALTALRKGIEDPDGALTDWDPNLVDPCTWFHVVCDGDNRVIRLDLGRLNLSGPLAPELGQLDQLQYMEIFGNSISGPIPSEFGSLANLISLDLSSNSISGAIPAALGNAKSLKFLRLDHNRLTGPIPRELAGLPNLGIVDFSNNDLCGAIPTDGAFQNIPR

HMMPfam: PF08263
IPR013210
59-98 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

SRDGDALTALRKGIEDPDGALTDWDPNLVDPCTWFHVVCD

Gene3D: G3DSA:3.80.10.10
60-224 no description

RDGDALTALRKGIEDPDGALTDWDPNLVDPCTWFHVVCDGDNRVIRLDLGRLNLSGPLAPELGQLDQLQYMEIFGNSISGPIPSEFGSLANLISLDLSSNSISGAIPAALGNAKSLKFLRLDHNRLTGPIPRELAGLPNLGIVDFSNNDLCGAIPTDGAFQNIPR

HMMPfam: PF13855
127-185 LRR_8,Leucine rich repeat

LQYMEIFGNSISGPIPSEFGSLANLISLDLSSNSISGAIPAALGNAKSLKFLRLDHNRL

Seg: seg
147-162 seg

SLANLISLDLSSNSIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox