PRGDB00064010 (Zm.18148)

From PRG Wiki
Jump to: navigation, search
Zm.18148
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224034624 (BT069491)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0148M16 mRNA, complete cds

DNA Sequence

CATTGTACCCCGCGGTGACGCGTCCCGGCCCCGGCGGCCGGCGGGTCTGCCTACCGGTACCGGCCCCGCTCGCTCGCCGAGTCAACGGCTTGACTGCGCCCGCCCGCCACGTTCGTAGTACTATACAAGTACATGCCTTTGCCTTCCCTTtcctctcctctcctcctctccCACAGTCCCACCCGTTTCGCAGTGCAGAAGCCGGCGAAACTTCCAAGCCCAAGGAAGGaaaaaaaaaaCTGTCACCTTTAACTCGATCCCCTCTTCCCCGCCCGAGTCAGAGCGGCGGCGCCGGAGCCGGAGCCGACAGCTTCCGGCAAGCGGGGGCTACTTGGTGCGGCGGGCTATTTCCGCGGTTTTGTGCCACAGCGGGACTGAACTGCCCGCCCAGGCTGCCCTATCAGGGTCACCAAGATTGAACAAGACTGAACTGCCGCGCTTCAGGATACTGAACTGCCATCTCAGTTAAATGATATACTGCACAACAGTGGGCAGCGATAGTTTGAGACACATTAGCAATGAGTTGTTTTTCTCACCTTTTCAAGAGAAAAAGGGGGCCACAACAACAAGACGATCCATCTGACAATTATTTCACTGGTTCTGAGAATATAACAAGATTCAGCTACAGGGAACTGGTTAGAGCCACATCAAATTTTGACCAAGGCAATAAGATTGGTGAGGGCGGCTATGGACCTGTCTACAAGGGAACACTCAAGGATGGGACACTTATTGCCGTGAAGGTTCTGTCTTTACATTCTAGACAAGGGGCAAAGGAGTTTCTTAATGAGCTTCTTGCAATCTCTGATGTAACACATGAGAATCTTGTCAAACTCTATGGCTGCTGTGTAGAAGGAAACCACAGGATCCTTGTCTACAATTATCTTGAAAATAATAGTCTTGCACATACCCTTCTAGATTCGCGACACAGCAACATCCAGTTCAACTGGAGAACTCGGGTAAATATCTGCATCGGTGTTGCCCAAGGATTAGCTTTCCTCCATGGCAGTGTCAGCCCTCACATTGTTCACCGTGACATCAAGGCGAGCAATATACTTCTTGATAAGGATATGACGCCAAAAATATCTGATTTTGGTCTGGCAAAGCTTCTACCTCCGGATGTATCACATGTTAGCACAAGAGTCGCAGGGACCCTAGGTTACTTGGCTCCTGAATATGCAATTCGAGGACATGTTACACGGAAGGCAGATGTCTACAGCTATGGCGTTCTGCTTATCGAAATTGTGAGCGGAAGATGCAACACTGATACGAAATTGCCCTATGATGACCAGATTCTCCTTGAGAAGACATGGAGATACTATGGTCGCGGGAATCTGGAGAAGATCATAGACAGCTCCCTTGGCGACGACCTGGACGTTGACGAAGCCTGCAGGTTTCTGAAGATCGGGCTCCTCTGCACCCAAGACGGCACGAAACGCCGGCCGGGCATGTCTGCGGTGGTGGCCATGCTGAGAGGCGAGGCGGACGTGGACACGGAGACGATCAGCAAGCCCGACGTGATCAGGGATTTCGGAGACCTGAAGCTGCGGAGCAGGGCCACGTCGTCCACGCTGCTGACCTCGATCATGGCGCGGTCGTCCCCGCTGTCGTCTGAGGAGACGACGCGCACCTCCATCACCTTCACCGAGATATCGGAGCGCGACTGACTGACGATCGCCGTTAATTCGCCGACAAGAAGTGGGCTGTGAGCCTGTGACCGTGTAGCTGGAGGAGCGGAAAGTGTACGTAGCATAGGCCGGGGAGAATTCTTTTTGCTGGTTTTATGTGATCTGTGTGCGTATTTCTATATTACAATCGCGGTAGGAAACGGCGCTTCAAAGACTATCCACGTCAGCTTCTAATTTATCATCCGTTGGAT


Protein sequences

Name Description Sequence
Zm.18148 translated coding region predicted by ESTScan from UniGene Zm.18148

MSCFSHLFKRKRGPQQQDDPSDNYFTGSENITRFSYRELVRATSNFDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEKTWRYYGRGNLEKIIDSSLGDDLDVDEACRFLKIGLLCTQDGTKRRPGMSAVVAMLRGEADVDTETISKPDVIRDFGDLKLRSRATSSTLLTSIMARSSPLSSEETTRTSITFTEISERD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF433
9-381 PTHR24420:SF433,SUBFAMILY NOT NAMED

KRKRGPQQQDDPSDNYFTGSENITRFSYRELVRATSNFDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEKTWRYYGRGNLEKIIDSSLGDDLDVDEACRFLKIGLLCTQDGTKRRPGMSAVVAMLRGEADVDTETISKPDVIRDFGDLKLRSRATSSTLLTSIMARSSPLSSEETTRTSITFTEISERD

HMMPanther: PTHR24420
9-381 PTHR24420,FAMILY NOT NAMED

KRKRGPQQQDDPSDNYFTGSENITRFSYRELVRATSNFDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEKTWRYYGRGNLEKIIDSSLGDDLDVDEACRFLKIGLLCTQDGTKRRPGMSAVVAMLRGEADVDTETISKPDVIRDFGDLKLRSRATSSTLLTSIMARSSPLSSEETTRTSITFTEISERD

superfamily: SSF56112
IPR011009
16-317 Kinase_like
Protein kinase-like domain

QQDDPSDNYFTGSENITRFSYRELVRATSNFDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEKTWRYYGRGNLEKIIDSSLGDDLDVDEACRFLKIGLLCTQDGTKRRPGMSAVVAML

Gene3D: G3DSA:3.30.200.20
28-108 G3DSA:3.30.200.20

SENITRFSYRELVRATSNFDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGC

ProfileScan: PS50011
IPR000719
46-363 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDQGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEKTWRYYGRGNLEKIIDSSLGDDLDVDEACRFLKIGLLCTQDGTKRRPGMSAVVAMLRGEADVDTETISKPDVIRDFGDLKLRSRATSSTLLTSIMARSSPLS

HMMPfam: PF00069
IPR017442
48-262 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QGNKIGEGGYGPVYKGTLKDGTLIAVKVLSLHSRQGAKEFLNELLAISDVTHENLVKLYGCCVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEK

Gene3D: G3DSA:1.10.510.10
109-262 G3DSA:1.10.510.10

CVEGNHRILVYNYLENNSLAHTLLDSRHSNIQFNWRTRVNICIGVAQGLAFLHGSVSPHIVHRDIKASNILLDKDMTPKISDFGLAKLLPPDVSHVSTRVAGTLGYLAPEYAIRGHVTRKADVYSYGVLLIEIVSGRCNTDTKLPYDDQILLEK

PatternScan: PS00108
IPR008271
168-180 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox