PRGDB00064012 (Zm.18542)

From PRG Wiki
Jump to: navigation, search
Zm.18542
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614363 (EU956894)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1576883 TAK14 mRNA, complete cds

DNA Sequence

ACACATCGCCACGCCACTGATTGGCTCGCGATTATGTGATTCTTGAACCTTCTTGCCATGGGGATGTCTGCAGCGTCTCATCTCTGTGCTTCTTCGTCCCTGCGAGCTTTAACCGTGTTGTTTGTGTTGGCAGCTCTTGTTTCAGATGTAGAGGGGCGACATCATCGTCATGTCTGTCCTCATTTCTCCTGTGGTGGTTTAAGCAATATATCGTATCCATTTCGTCGGCAAGGTGATCCATCTGGGTGCGGTGTCCAATCGTATGAGCTGGTTTGCACGGATACAGATGCTACAATTCGCATCGGCAGTGGAACATACAAGGTGCTTAGCATCAACTCCACATATTCTTACTTCTGGGTTGTTGATGCCGACCTGGACATCCAGAGCAGTTGCCCCCTTCCCCAGTGGGATTATTACCCTGCTCGTTGGATCAATCGCAACTCATATCGTTGGAGGATTGAGTTCAGCCATGATTATTTCTATCCTCCTCCTTTTTATATTTATTCGGGGTGGGCTATCTTTGTGAATTGTTCTCAGCCAATAGAGAACAATGATGCTGATATATATGAGCCGGTGTCTTGCTTGAGCAATTCTTCTTTCATCTACTTGGTAACTGACTACTGGTATGTTTTTGCTGGGAATCTGGAGCCTTCATGCGGTTACCTAGCCATGACTCCTTTGGGTGGTCCAGGCATGCCGGTGCCCATGAATACAAGCTATCCAGATGTTGTTAAGTTCATGAGGAGTGGATTTGCCCTTCGATTTCCCTTTTCGTATGGTGACAACATCAGAGAATGTCTCGCAAACAATATGCATACTTTCCATAAAGAACCAAGAAATAGTACAGGCATCAGGCAACAGATCTTGGACATTCTTACGTTCGAGACATTATGGTTTTGTGTTATTGAACAACTTGGATCAACTAATAATGGTGTCAAGTCTGTTCTCATCGACATCATCCAACAAATACCATATGTTCTTTCCAGTCTGAAATCTGCACATGTTATTTGCAGGTTCGTATTGATGCCGCTGGCGGTATTTGTCTTCCTAGCCTATAAATACTGGAAAACACGGATAACAATAGATGCAGTTGAGAAGTTCCTGCGAATGCACCATATGCTCGTTCCGATGAGATATGCATACACAAACATCATTGCTATCACCGCCCATTTCAGAGACAAGCTCGGACAAGGAGGCTACGGTACTGTATACAAAGGGGNNNNNCAACCAGGTGAAGTTCATGTTGCTGTCAAGATGCTGGGCAACTCAAACTGTAACGGAGAAGAGTTCATCAGTGAGGTGGCCACCATTGGAAAGATCCACCATGTCAATGTTGTGCGCCTCATTGGATTTTGCTCCGAGGAAAATATCAGGGCACTTATCTATGAGTTCATGCCCCGTGGATCTCTCGATAAGTACATCTTCTCGTCGGAGAAGACATTCTCATGGGACAAACTCAATGAGATCGCTCTGGGCATTGCTAGAGGTCTTAACTACCTGCATCACGGGTGTGATATGCAAATAGTACACTTTGACATCAAGCCACACAACATCCTTCTTGATAGCAACTTTGTTCCAAAAGTTGCTGATTTTGGGCTAGCCAAACTGTTCCCAAGAGATGACAGTTTCGTGCCACTGAGCGCTATGCGAGGAACGATAGGCTATATAGCTCCAGAGATGGTATCTCGAAGCTTTGGTGTCATCTCTAGCAAATCCGATGTGTACAGCTTTGGGATGCTACTATTGGAGATGACGGGCGGGCGAAGAAACGCAGATCCTCATGCAGGAAGCTCTAGTCAAGCATACTACCCATCCTTGGTGTACAGGCAGCTGAGCCAAGGTGATGCGAACAGGATCAGTGAAGGTGTTGATATGCACGAGTTAGAGAAGAAGCTATGTATAATTGGGCTTTGGTGCATCCAGATGAAGCCGCAAGATCGGCCGACGATGAGCGAGGTCATAGAGATGCTTGAAGCTGGTGTCGATGGCATCCAAATGCCTCCAAGGCCATACTTTTGTGATGAAGAGGGTGACAGTTCTTACTCTATAATCTCTGAACTGGATACAATAGAAGagtagtagtagtagtaAAATGCACTTGTGTCTATGTGCTCTTAATGTATCAGACTATTAAGATTGCAAGGTGGCCATAGGCTAAGGTACTGGTTGTATGCTTTTATTGAGTGTGTGGTAATGTGTTTTGATATAAAATACCTCCATGAACCTTTTTTTACAAAGAACTCAAGAACATTTTGTTTGCCTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.18542 translated coding region predicted by ESTScan from UniGene Zm.18542

THRHATDWLAIMXFLNLLAMGMSAASHLCASSSLRALTVLFVLAALVSDVEGRHHRHVCPHFSCGGLSNISYPFRRQGDPSGCGVQSYELVCTDTDATIRIGSGTYKVLSINSTYSYFWVVDADLDIQSSCPLPQWDYYPARWINRNSYRWRIEFSHDYFYPPPFYIYSGWAIFVNCSQPIENNDADIYEPVSCLSNSSFIYLVTDYWYVFAGNLEPSCGYLAMTPLGGPGMPVPMNTSYPDVVKFMRSGFALRFPFSYGDNIRECLANNMHTFHKEPRNSTGIRQQILDILTFETLWFCVIEQLGSTNNGVKSVLIDIIQQIPYVLSSLKSAHVICRFVLMPLAVFVFLAYKYWKTRITIDAVEKFLRMHHMLVPMRYAYTNIIAITAHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEMLEAGVDGIQMPPRPYFCDEEGDSSYSIISELDTIEEXXXXXNALVSMCS

Domains

Domain Start-End Description Sequence

Seg: seg
23-47 seg

SAASHLCASSSLRALTVLFVLAALV

HMMPfam: PF13947
IPR025287
59-123 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

CPHFSCGGLSNISYPFRRQGDPSGCGVQSYELVCTDTDATIRIGSGTYKVLSINSTYSYFWVVDA

HMMPanther: PTHR24420:SF441
335-703 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VICRFVLMPLAVFVFLAYKYWKTRITIDAVEKFLRMHHMLVPMRYAYTNIIAITAHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEMLEAGVDGIQMPPRPYFCDEEGDSSYSIISELDTIEEXXXXXNALVSM

HMMPanther: PTHR24420
335-703 FAMILY NOT NAMED,FAMILY NOT NAMED

VICRFVLMPLAVFVFLAYKYWKTRITIDAVEKFLRMHHMLVPMRYAYTNIIAITAHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEMLEAGVDGIQMPPRPYFCDEEGDSSYSIISELDTIEEXXXXXNALVSM

superfamily: SSF56112
IPR011009
361-657 Protein kinase-like (PK-like)
Protein kinase-like domain

IDAVEKFLRMHHMLVPMRYAYTNIIAITAHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEML

Gene3D: G3DSA:3.30.200.20
380-465 no description

AYTNIIAITAHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFM

ProfileScan: PS50011
IPR000719
389-672 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

AHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEMLEAGVDGIQMPPRPYF

HMMSmart: SM00219
IPR020635
389-657 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEML

HMMSmart: SM00220
IPR002290
389-657 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

AHFRDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEML

HMMPfam: PF00069
IPR017442
392-655 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RDKLGQGGYGTVYKGXXQPGEVHVAVKMLGNSNCNGEEFISEVATIGKIHHVNVVRLIGFCSEENIRALIYEFMPRGSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIE

PatternScan: PS00107
IPR017441
395-418 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGYGTVYKGXXQPGEVHVAVK

Gene3D: G3DSA:1.10.510.10
468-659 no description

GSLDKYIFSSEKTFSWDKLNEIALGIARGLNYLHHGCDMQIVHFDIKPHNILLDSNFVPKVADFGLAKLFPRDDSFVPLSAMRGTIGYIAPEMVSRSFGVISSKSDVYSFGMLLLEMTGGRRNADPHAGSSSQAYYPSLVYRQLSQGDANRISEGVDMHELEKKLCIIGLWCIQMKPQDRPTMSEVIEMLEA

PatternScan: PS00108
IPR008271
508-520 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDIKPHNILL

Seg: seg
691-697 seg

EEXXXXX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox