PRGDB00064014 (Zm.18799)

From PRG Wiki
Jump to: navigation, search
Zm.18799
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194692729 (BT035444)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0063E24 mRNA, complete cds

DNA Sequence

GAGAATTGTGACTCCTGTGTGGAGAATTCATTGCTAGATCGCAACGCACCGTCGTCTTGTTTTAATCGCATGAGGAGATCGAAGCGATGATGTCGCGTACGAACACCGGCGGCACGTCGGCGCGACAGAACAGCGACGAGTCTGTCTCCCCGAGGTGCGTCCTCGACGACGGCGGCTATAGGATGAGCACCAGCAACGCCGGCAGTAGCACCACGACCACCATGGCCAGCGGCAGCAGTACCCCAGCAACGACGAGCGCGTCGTCTCCAGCTACAACGGTGGCGGTGACGACGTACACCGACCCATCCGCGCTACTGAAGgcggccgggcggcgcgacgggtcggcggcgccgccgtggaaggccgtggccgaggcgtggcggTCCAGGGCCAAGCGCCAGCTCTCTGTCCGCATCCCGTCGTTAGGGCCCACGATGTCGTCGACACTGCGGCGTCTGAGCAGCCGCCGGACGGACAACATCGAGGTGCACGAGTTCTGCGTCCTCAAGCCGACCCTCCGCACTTTCTCCCTCGCCGAGCTCAAGAAGGCCACCCGCAACTTCAGCAAAGAGAACGTGGTGGGCAGGGGAGGGTTCGCCAAGGTGTATCGAGGCAGCCTCCCCGGCGGCGAGCTGGTGGCGGTGAAGAAGCTGACGGCAACGCAGGGGGCCGAACGGATGGAGGGCTTCCTGTCGGAGCTGGGGCACGTGGTGAACGTGAGCCACCCCAACATCGCCAGGCTCGTGGGCGTGGGCGTCGACGGCGGCGAGCACCTCGTGTTCCCCTTCTCCCGCCTCGGCTGCCTCTCCGGGATGCTCCACAGCAACAGCGGCGCAGAGCCCATGCCGTGGGAGGCGAGGTACAGGGTGGCGCTGGGCACTGCGCGCGGGCTAGAATACTTGCACGAGAGGTGCGCCCGGAGAATCGTGCATAGGGACATCAAGCCCGCCAACATCCTCCTCATGGACAACTATGAACCCCTGATCTGCGATTTCGGGCTGGCGAGGTGGCTGCCGGCGAAGCTGACGCACCTGCAGGTGAGCGTGTTCGAGGGCACCTTCGGCTACGTGCCGCCCGAGTACACGACGCACGGCGTGTTCAGCGAGAAGACGGACGTGTTCGCTCTCGGCGTCGTGCTGCTCGAGCTCCTCACCGGCCGCCGCGCCGTCGACACCGCCAAGCTCAGCCTCGTCGCATGGGCAAAGCAGTACCTCGAAGtcgacgacgacgacgaggacgagacCCTCAAGATGGCCGACCCAGCGCTGGGCGGCCGGTACGACGCCGAGCAGCTCCGGAACATGGCGTGGGCGGCCAAGCTCTGCGTCCACGCCTCCCCGCACCAGCGCCCACAGATGAGCGAGGTGGTGCAGATACTAGCAGGAGAGGGGGCGCATCTACGTGGCGGCAGGGGGGCCCACGGGGTCGACGACGAGCTGCTGCCGGAGACGGACGGCTACGACGGCGACGCGGCGCCTGGGTACGTGGATGATCTGAGCCGCCATAAGGCGCTCGCCTTCGCCGTCGACGTCGACGTGGACTCGGACGAGGATTCCACGCCACCAGTGCGACACGCACCCGCCACCACGTTTGTTCGTGAAGTGTAGCTGGGCACGGTCGCACGGGCGGGCGGCAACGACATCCTCttttttttGTCGTGCCTGTGATGATGTGTATATTTTGCATATGTATATACAAAATTAAAGGGAAAGAATTGTCAGATTGCGGCATTGTGTATGGTGCGAGTGAGGAAGAAGCTGAGGAAATCAAAGGGGTAATTGAAAATTGGCATATTGAGTCACCGAACTGCCAAAACC


Protein sequences

Name Description Sequence
Zm.18799 translated coding region predicted by ESTScan from UniGene Zm.18799

MSRTNTGGTSARQNSDESVSPRCVLDDGGYRMSTSNAGSSTTTTMASGSSTPATTSASSPATTVAVTTYTDPSXATEGGRAARRVGGAAVEGRGRGVAVQGQAPALCPHPVVRAHDVVDTAASEQPPDGQHRGARVLRPQADPPHFLPRRAQEGHPQLQQRERGGQGRVRQGVSRQPPRRRAGGGEEADGNAGGRTDGGLPVGAGARGEREPPQHRQARGRGRRRRRAPRVPLLPPRLPLRDAPQQQRRRAHAVGGEVQGGAGHCGGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQILAGEGAHLRGGRGAHGVDDELLPETDGYDGDAAPGYVDDLSRHKALAFAVDVDVDSDEDSTPPVRHAPATTFVREV

Domains

Domain Start-End Description Sequence

HMMSmart: SM00219
IPR020635
19-430 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VSPRCVLDDGGYRMSTSNAGSSTTTTMASGSSTPATTSASSPATTVAVTTYTDPSXATEGGRAARRVGGAAVEGRGRGVAVQGQAPALCPHPVVRAHDVVDTAASEQPPDGQHRGARVLRPQADPPHFLPRRAQEGHPQLQQRERGGQGRVRQGVSRQPPRRRAGGGEEADGNAGGRTDGGLPVGAGARGEREPPQHRQARGRGRRRRRAPRVPLLPPRLPLRDAPQQQRRRAHAVGGEVQGGAGHCGGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQIL

Seg: seg
32-68 seg

MSTSNAGSSTTTTMASGSSTPATTSASSPATTVAVTT

Seg: seg
77-103 seg

EGGRAARRVGGAAVEGRGRGVAVQGQA

ProfileScan: PS50011
IPR000719
155-437 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HPQLQQRERGGQGRVRQGVSRQPPRRRAGGGEEADGNAGGRTDGGLPVGAGARGEREPPQHRQARGRGRRRRRAPRVPLLPPRLPLRDAPQQQRRRAHAVGGEVQGGAGHCGGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQILAGEGAHL

HMMSmart: SM00220
IPR002290
155-408 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

HPQLQQRERGGQGRVRQGVSRQPPRRRAGGGEEADGNAGGRTDGGLPVGAGARGEREPPQHRQARGRGRRRRRAPRVPLLPPRLPLRDAPQQQRRRAHAVGGEVQGGAGHCGGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWA

Seg: seg
159-176 seg

QQRERGGQGRVRQGVSRQ

Seg: seg
179-195 seg

RRRAGGGEEADGNAGGR

Seg: seg
212-254 seg

PPQHRQARGRGRRRRRAPRVPLLPPRLPLRDAPQQQRRRAHAV

Gene3D: G3DSA:1.10.510.10
265-432 no description

CGGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQILAG

HMMPfam: PF00069
IPR017442
266-428 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GGLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQ

superfamily: SSF56112
IPR011009
267-428 Protein kinase-like (PK-like)
Protein kinase-like domain

GLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQ

HMMPanther: PTHR24420
267-433 FAMILY NOT NAMED,FAMILY NOT NAMED

GLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQILAGE

HMMPanther: PTHR24420:SF794
267-433 SUBFAMILY NOT NAMED

GLEYLHERCARRIVHRDIKPANILLMDNYEPLICDFGLARWLPAKLTHLQVSVFEGTFGYVPPEYTTHGVFSEKTDVFALGVVLLELLTGRRAVDTAKLSLVAWAKQYLEVDDDDEDETLKMADPALGGRYDAEQLRNMAWAAKLCVHASPHQRPQMSEVVQILAGE

PatternScan: PS00108
IPR008271
279-291 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPANILL

Seg: seg
378-384 seg

DDDDEDE

Seg: seg
430-445 seg

LAGEGAHLRGGRGAHG

Seg: seg
479-489 seg

VDVDVDSDEDS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox