PRGDB00064016 (Zm.19185)

From PRG Wiki
Jump to: navigation, search
Zm.19185
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195644959 (EU969830)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 336179 serine

DNA Sequence

CTCCCGCGGCCATTGCAGGTCTTGCAGCAACGTCTCTCTCCTCTGGGCGGTGGGCGCTCGATGTTCTTGGCTCCTTCACTTGGACTTCGCCCCGTCGGCGTCCACTGATCAATTGATCATCTGCAGGTAGATAAGCTACCAGCATCTATTTTGCGTATCTGAACTCCAAAAAGGAGAGCTCGAAACTACAGCAATGGGTTGCTACCCTGTGTTCTGTAGGAAGAAGAACTCCAGAAGCCAGGTTGTGCAGCTTGACCAAGACATCCCAATCGCGGGCAACGTGAAAATCTACTCGTCCAAGGAGCTGAGGAAAGCCACGGGAAATTTCTGCCCGGGAAGCAAGCTTGGACAGGGTTCTTTCGGCCGTGTATACCTGGGAAAACTGAACAATGGCGAGAAAGTTGCCATCAAGGTGCTCTCCTCAGAGTCCAGGCAAGGGACAAAGGAGTTCTTGAATGAACTGAGTGTCATATCCAACATAACTCACCACAACCTTGTCAAACTGCATGGCTGCTGCATCGACGGAGGCCAGAAGATGCTGGTCTACAACTACGTGGAGAACAACAGCCTTGCACAAACCCTTTTCGGTAATTCCCGCAGCGGCATCAGATTTGACTGGAGAACAAGGGTGGAGATCTGCGTTGGCGTTGCCGATGGGCTCACGTACCTCCACGAAGAAGTCCGTCCACCGATCGTCCACCGCGACATCAAAGCGAGCAACATCCTTCTCGACAGAAATCTGAGACCCAAGATAGCAGACTTTGGGCTGGCGAAGTTCTTCCCTGGCAACATGACACACATCAGCACCAGAGTTGCAGGGACGCTAGGATATCTTGCGCCAGAGTACGCCATCCGAGGGCAGCTGACCAAGAAGGCCGACGTCTACAGCTTTGGTGTACTGCTGCTGGAGATCGTCAGTGGCAGATGCCACACTGATCCCACATTACCTCTTGACGAGCAGTTCCTCCTAGAAAAGGTCTGGACACTCTCGGAGTCCGATGATCTTGAGAGCATCATCGACGGTACCATGGAGCGCGATTTCGACACCGAGGAAGCACGTCGGTTGCTGAAAATAGGTCTTCTGTGCACCCAGGATAGCCCCAAGATCAGGCCCTCCATGTCAATGGTTGCCAAGATGCTGAAGGGTGAGTGTGATGTGAGTGAAAAGATCATGCGGCCCAGCCTGATCACAGACGTCATGGACCTGAAAGTCAGGACAGTAGAGCCGATCCAGTTCAGTTTATCCCCATCGATGTCACCTGCGCTGAGCAGCTCACTGGTGTCCACACTTGCATTAGCTGGTAGCACAGTTGTAGAGAGCCGCTGAAGGAACTAGTTAAAGGACCAGGTTCCTACAAAAAATGGTTTGTTAGAAGCAGCATGAAttgtttttttgtttgtgttttAGTACATTGTAAGGTTGTCAGTTTGTATATATAACATCCTAGTTTGATTATCGAGATTAGAGATTTTGGCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.19185 translated coding region predicted by ESTScan from UniGene Zm.19185

MGCYPVFCRKKNSRSQVVQLDQDIPIAGNVKIYSSKELRKATGNFCPGSKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHGCCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAKMLKGECDVSEKIMRPSLITDVMDLKVRTVEPIQFSLSPSMSPALSSSLVSTLALAGSTVVESR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-334 PTHR24420,FAMILY NOT NAMED

VFCRKKNSRSQVVQLDQDIPIAGNVKIYSSKELRKATGNFCPGSKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHGCCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAKMLKGECDVSEKIMRPSLITD

superfamily: SSF56112
IPR011009
15-316 Kinase_like
Protein kinase-like domain

SQVVQLDQDIPIAGNVKIYSSKELRKATGNFCPGSKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHGCCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAKML

Gene3D: G3DSA:3.30.200.20
28-106 G3DSA:3.30.200.20

GNVKIYSSKELRKATGNFCPGSKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHG

ProfileScan: PS50011
IPR000719
45-331 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FCPGSKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHGCCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAKMLKGECDVSEKIMRPSL

HMMPfam: PF07714
IPR001245
49-315 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SKLGQGSFGRVYLGKLNNGEKVAIKVLSSESRQGTKEFLNELSVISNITHHNLVKLHGCCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAKM

PatternScan: PS00107
IPR017441
51-73 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGSFGRVYLGKLNNGEKVAIK

Gene3D: G3DSA:1.10.510.10
107-314 G3DSA:1.10.510.10

CCIDGGQKMLVYNYVENNSLAQTLFGNSRSGIRFDWRTRVEICVGVADGLTYLHEEVRPPIVHRDIKASNILLDRNLRPKIADFGLAKFFPGNMTHISTRVAGTLGYLAPEYAIRGQLTKKADVYSFGVLLLEIVSGRCHTDPTLPLDEQFLLEKVWTLSESDDLESIIDGTMERDFDTEEARRLLKIGLLCTQDSPKIRPSMSMVAK

PatternScan: PS00108
IPR008271
167-179 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox