PRGDB00064017 (Zm.19600)

From PRG Wiki
Jump to: navigation, search
Zm.19600
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195659006 (EU976853)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 991888 ATP binding protein mRNA, complete cds

DNA Sequence

CTTCGCCTCAGTCACACGCCTCGATCTCGCCTCGCCGCGCTCCCACCACCGCACCATCCCGGCCGCCTCGCTCGCGACGCACCAAGGTGCCCTCGTATCCCGCGGCGCCGGATTGGGTTCCCTCCGGGGATCACGCGGCGAGCCTCGCCGCTCGAGCCACAGGATAATATGTTCAATCTGTTTCCTTGTTCATTTAAACGTAGAGTGGCCTTGAAGGATGATAATTGAAGCAAAATGATTCTCTATTTCACCATATTTTGGAGATGGATGATCTGCCAGGAGATGAAGGAAGATCCCAGACACACCCTTCAGACCGGAATTGGCCCTCCCATTTGGAGCAGAAGTTCCAGTCCCTGCCCCTGACTAAACAGGAAAGGAATTTTGATTCTGCATATTCTTCCCTTGATTCTAGGGAAGTTGGTCATTCATTGCAGGCTGCTCAGACATTATGGTCTAGCGGATCCCTTTCAGGTCCAATACCCAATGGTTTTTATTCCATTATTCCGGAAAAGAGACTCAAGGAGCATTTTGATACCATACCTTCTCCTGATGACCTTTATTCTCTTGGAATAGAAGGATTTAAGGCTGAGATTATCCTTGTGGACATAGAAAGAGATAAAAAGCTATCTGCTTTAAAGCAGTTATGCACAGCACTGGTAAAAGGATTGAATTCAAATCCTGCTGCAATGATaaaaaaaaTTGCAGGTTTGGTTTTTGACTTCTACAACCGACCAAACCCACATCTCAGTCCTGCAAGAACATCCTCTGAAGATCTTTCCAATTTATTAGAAAATCGAGGAGTTCAATTGCTGGGACAGATAAGACATGGATCTTGCAGGCCCAAAGCTATATTATTTAAAGTCCTTGCTGACTCAGTTGGTATAGATTCTAAACTGCTGGTGGGCATTCCAAATGAAGAACCTCATGGATATGATAATTCATCCAAACATATGTCTGTTGTGGTCATTCTGAAATCTGCGGAGTTTCTAGTTGACCTGATGCGTTTTCCAGGACAACTAGTTCCATTTTCATCCAAAGCTGTTGTCACATCCCATATGTCTGCAACTGGAGAAAGTGATTCAGCCGACTATGATTCCTGTGATTCTCCTCTTGAACCAAATAGTCCTCTATGTGCTCAAAGGCAAGAGCAAGATGATGGCAATAGATCCTTCAAAGTCCTCTCACTAAGAAACATCATGCTCAAATCGACAAATTCTATGGAGGGTAAAATGAGTTGTTCATCTCATAGTGAGCCGAATGTTGCAAATGCCTTCTGTGGTCGCAGCCGCGATAAAGTTGTGGATGAACATCAAAGAACTGCAAGCTCAAGTCCAGAGCATCCACTGTCCAGAGTTCGTGGGCGCTCAATGCTGGGTGATAAACAATATGGTGGTGCTGTAGCAGTGTCAAGGTCAGATGGCGCATCAACATCAAATACACATAGAGCACGGAGAAGTACTAATATTACTCCTGAAATCAGTGATGATATTGTGAGAGCAGTTCGAGCAATGAGTGAAAGCATGAGACAAAATCGCCTTTCAAGGGAGCAGAAGGATGGTAGTCTTGGATCCTCAAATGATTCAATGAAACATGAACCTGCTGGTGACTCCAATGATGATGAAGCATCCACAAGACGACCGAGTGCACTGGAGGGTTTGAGAAGGCAATTTAATAGTCAGAAAGCTGTGTCATTGCCTTCGTCGCCCAATAGGTCAGGTATTCTTGGCCTCAGGAGCCCATCTGACTATACAGAAGCCGATCTGATGGCGACCTGGAATGAGGTGTTGCAGTCTTCACCATTTCTGAACAAGCCTTTATTGCCTTATGAGGAATGGTGCATTGAGTTTTCAGAGATCACTGTTGGCATTCGTGTGGGAGTAGGGTTTTTTGGGGAAGTCTTCCGTGGCCTTTGGAACGGAACAGATGTAGCTATAAAAGTATTTCTGGAGCAGGATTTGACAACAGAGAATATGAAAGATTTCTGCAACGAGATATCAATACTTAGCCGACTTCGACACCCCAATGTCATACTCTTTCTTGGTGCATGTATGAAGCCTCCTCACTTATCCCTAGTCACTGAGTACATGGAAGTGGGTTCTTTGTATAGTTTGATTCACTCAAAAACACAGAAAACTAAGCTCCATTGGAAGAGGAGGTTAAAGATGCTCCGTGATATCTGTAGGGGTCTCATGTGCATGCACCGGCTAAAGATTGTTCACCGGGACCTCAAGAGTGCAAATTGCCTCGTTAACAAATACTGGACAGTCAAGATATGTGATTTTGGGCTCTCTCGAGTAATGTCAAATTCTGCAATGAATGACAACTCATCTGCGGGAACTCCAGAGTGGATGGCTCCTGAGCTCATTCGCAACGAGCCATTCACAGAAAAATGTGATATCTTCAGCTTCGGGGTCATCATGTGGGAGCTTTGCACTCTTTGTAGACCTTGGGAAGGAATTCCACCTGTTCAGATCGTTTACTCTGTTGCGAATGATGGGGCAAGACTGGAAATACCAGATGGGCCTCTTGGAAGCTTGATAGCAGATTGCTGGGCAGAACCGGAGAGGCGTCCATGCTGCCAGGAGATCCTGACCCGCCTTCTTGATTGCGAGTATACCTTGTGCTGAGGCTTTGCTTCTAGTCTGTATAGCGGTTATAGGGGCATCAGACGGTCTGGCTTATATATACATCACTTAATTTTCCATTTCACATACATCATTGAGGGTGTAAATTACCATGTATTAATAAGCAAACTTTTTCTAAACCTCTTTAATGCTATTGCCCCAAAATCCaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.19600 translated coding region predicted by ESTScan from UniGene Zm.19600

MDDLPGDEGRSQTHPSDRNWPSHLEQKFQSLPLTKQERNFDSAYSSLDSREVGHSLQAAQTLWSSGSLSGPIPNGFYSIIPEKRLKEHFDTIPSPDDLYSLGIEGFKAEIILVDIERDKKLSALKQLCTALVKGLNSNPAAMIKKIAGLVFDFYNRPNPHLSPARTSSEDLSNLLENRGVQLLGQIRHGSCRPKAILFKVLADSVGIDSKLLVGIPNEEPHGYDNSSKHMSVVVILKSAEFLVDLMRFPGQLVPFSSKAVVTSHMSATGESDSADYDSCDSPLEPNSPLCAQRQEQDDGNRSFKVLSLRNIMLKSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSSPEHPLSRVRGRSMLGDKQYGGAVAVSRSDGASTSNTHRARRSTNITPEISDDIVRAVRAMSESMRQNRLSREQKDGSLGSSNDSMKHEPAGDSNDDEASTRRPSALEGLRRQFNSQKAVSLPSSPNRSGILGLRSPSDYTEADLMATWNEVLQSSPFLNKPLLPYEEWCIEFSEITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRLLDCEYTLC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257
1-787 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

MDDLPGDEGRSQTHPSDRNWPSHLEQKFQSLPLTKQERNFDSAYSSLDSREVGHSLQAAQTLWSSGSLSGPIPNGFYSIIPEKRLKEHFDTIPSPDDLYSLGIEGFKAEIILVDIERDKKLSALKQLCTALVKGLNSNPAAMIKKIAGLVFDFYNRPNPHLSPARTSSEDLSNLLENRGVQLLGQIRHGSCRPKAILFKVLADSVGIDSKLLVGIPNEEPHGYDNSSKHMSVVVILKSAEFLVDLMRFPGQLVPFSSKAVVTSHMSATGESDSADYDSCDSPLEPNSPLCAQRQEQDDGNRSFKVLSLRNIMLKSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSSPEHPLSRVRGRSMLGDKQYGGAVAVSRSDGASTSNTHRARRSTNITPEISDDIVRAVRAMSESMRQNRLSREQKDGSLGSSNDSMKHEPAGDSNDDEASTRRPSALEGLRRQFNSQKAVSLPSSPNRSGILGLRSPSDYTEADLMATWNEVLQSSPFLNKPLLPYEEWCIEFSEITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRLLDCEYTLC

HMMPanther: PTHR23257:SF158
1-787 PTHR23257:SF158,SUBFAMILY NOT NAMED

MDDLPGDEGRSQTHPSDRNWPSHLEQKFQSLPLTKQERNFDSAYSSLDSREVGHSLQAAQTLWSSGSLSGPIPNGFYSIIPEKRLKEHFDTIPSPDDLYSLGIEGFKAEIILVDIERDKKLSALKQLCTALVKGLNSNPAAMIKKIAGLVFDFYNRPNPHLSPARTSSEDLSNLLENRGVQLLGQIRHGSCRPKAILFKVLADSVGIDSKLLVGIPNEEPHGYDNSSKHMSVVVILKSAEFLVDLMRFPGQLVPFSSKAVVTSHMSATGESDSADYDSCDSPLEPNSPLCAQRQEQDDGNRSFKVLSLRNIMLKSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSSPEHPLSRVRGRSMLGDKQYGGAVAVSRSDGASTSNTHRARRSTNITPEISDDIVRAVRAMSESMRQNRLSREQKDGSLGSSNDSMKHEPAGDSNDDEASTRRPSALEGLRRQFNSQKAVSLPSSPNRSGILGLRSPSDYTEADLMATWNEVLQSSPFLNKPLLPYEEWCIEFSEITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRLLDCEYTLC

HMMPfam: PF14381
57-254 EDR1,Ethylene-responsive protein kinase Le-CTR1

QAAQTLWSSGSLSGPIPNGFYSIIPEKRLKEHFDTIPSPDDLYSLGIEGFKAEIILVDIERDKKLSALKQLCTALVKGLNSNPAAMIKKIAGLVFDFYNRPNPHLSPARTSSEDLSNLLENRGVQLLGQIRHGSCRPKAILFKVLADSVGIDSKLLVGIPNEEPHGYDNSSKHMSVVVILKSAEFLVDLMRFPGQLVP

superfamily: SSF56112
IPR011009
501-779 Kinase_like
Protein kinase-like domain

MATWNEVLQSSPFLNKPLLPYEEWCIEFSEITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRL

Gene3D: G3DSA:3.30.200.20
515-593 G3DSA:3.30.200.20

NKPLLPYEEWCIEFSEITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLG

ProfileScan: PS50011
IPR000719
531-786 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ITVGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRLLDCEYTL

HMMPfam: PF07714
IPR001245
533-779 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VGIRVGVGFFGEVFRGLWNGTDVAIKVFLEQDLTTENMKDFCNEISILSRLRHPNVILFLGACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILTRL

PatternScan: PS00107
IPR017441
537-558 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGVGFFGEVFRGLWNGTDVAIK

Gene3D: G3DSA:1.10.510.10
594-777 G3DSA:1.10.510.10

ACMKPPHLSLVTEYMEVGSLYSLIHSKTQKTKLHWKRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKYWTVKICDFGLSRVMSNSAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIMWELCTLCRPWEGIPPVQIVYSVANDGARLEIPDGPLGSLIADCWAEPERRPCCQEILT

PatternScan: PS00108
IPR008271
650-662 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSANCLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox