PRGDB00064018 (Zm.19602)

From PRG Wiki
Jump to: navigation, search
Zm.19602
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195635872 (EU965287)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 285037 shaggy-related protein kinase eta mRNA, complete cds

DNA Sequence

GTGGGTGGCGGTCTGGCGGAGGACAGGAAGAAAAAACAAGGCGAAAAAGGAGGTTCGGGGCGGGTTCCATGGCGCTGCCTTCCTAGCCCAGCCGCCTCACCAACCTCCCTCCTCACCGAGGAGAGACCGAGGCGCCAACAGAGAACAGGACACTGCGAGAAGAGGAGGTTCATTTCCGCGTCGTCTCCGCCCGCAGCCCCACCCACCACATGGCAGCCATGCCGGGTGGGGCCCACGCCGCCGGCGCCGCGGACCAGATGCAGGTGGACCAGCCGCTCCCCGCTGCGGCCGCACACGGCCCCGCCGTCGCCAAGCATGCTGGTTCTATGATTGAAGGGAGTGATCCAGTCACGGGTCATATAATCTCAACAACCATTGGAGGGAAGAATGGAGAGCCTAAAAAGACTATCAGCTACATGGCAGAGAGAGTTGTGGGAACTGGATCATTCGGAATCGTCTTCCAGGCAAAATGTCTGGAGACTGGTGAGACTGTTGCTATCAAGAAGGTTTTGCAGGACAAGCGCTACAAGAACAGGGAGCTGCAAATCATGCGATCCATGGATCACTGCAATGCTGTTTCCTTGAAGCATTGTTTCTTCTCCACCACAAGCAGAGATGAACTTTTTCTTAACTTAGTGATGGAGTTTGTTCCTGAGTCACTATATCGTGTGCTGAAGCACTACAGCAATATGAACCAGAGGATGCCGCTTATTTATGTTAAATTATATACCTACCAGATATTTCGAGGTTTAGCCTATATTCACACAGTACCTGGTGTTTGTCACAGGGATGTGAAACCACAGAATCTTTTGGTTGATCCATTGACTCACCAAGTGAAGATATGTGATTTTGGGAGTGCCAAAATGTTGGTCAAAGGTGAAGCAAACATTTCATATATATGCTCACGTTATTACCGTGCTCCAGAGCTCATATTTGGGGCAACCGAGTACACAACATCAATTGATATTTGGTCAGCTGGATGTGTTCTTGCTGAGCTGCTTCTTGGCCAGCCTCTCTTCCCTGGCGAAAGTGCTGTGGATCAACTTGTTGAGATAATAAAGGTTCTTGGTACTCCAACACGTGAGGAAATCCGTTGTATGAATCCAAACTACACCGAGTTTAGATTTCCTCAGATCAAAGCTCACCCATGGCACAAGATTTTCCACAAGCGGATGCCTCCAGAAGCTATAGATCTCGCTTCACGTTTGCTCCAGTACTCACCAAATCTAAGATGCACTGCTCTTGAAGCGTGTGCACATCCATTCTTTGATGAGTTGCGAGAGCCACATGCGAGGTTGCCAAATGGACGGCCATTTCCTCCACTGTTCAACTTTAAACAGGAACTAGCAAATGCCTCCCCGGAGCTCATCAACAGGCTGATCCCAGACCATGCTAGGCGGCATCTTGGGCTCACTTTATTGCCCACCACTGGACCATAGGCGAAGGCTCTATGGTGTTYTAAACCTTTGCTCTTTCTGATTCTTCGTTGTTGCCATAGGCAATTCAAGGTGTAGAATCTGACCATTATTGGAAAGCCAAACACGAGCTGGCGCCAATGTGTTGCATAAGGAGAGGCGGTATGTTCGTGCAGCCAGCCTTTTGTCGCCTGTTTTAATGCAAAATCTGATTTTACTTAAGCAGTGTGAGGGGAAGTGGGTTGGTGTATTGTTAAGCTATTGAAGGAATTCAATCCCTGGTATTGTATTACTTTCTCCAACGTTAAATGTTGTAGTTCGCCTGTAAGTGTTCCACATCGCCTGTTGTTCAGTCCGCAATCCTTCCTGTAAATGTTATTAATGaaaaaaaaacatcttgctatgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaR


Protein sequences

Name Description Sequence
Zm.19602 translated coding region predicted by ESTScan from UniGene Zm.19602

VGGGLAEDRKKKQGEKGGSGRVPWRCLPSPAASPTSLLTEERPRRQQRTGHCEKRRFISASSPPAAXTHHMAAMPGGAHAAGAADQMQVDQPLPAAAAHGPAVAKHAGSMIEGSDPVTGHIISTTIGGKNGEPKKTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTTGP

Domains

Domain Start-End Description Sequence

Seg: seg
59-84 seg

SASSPPAAXTHHMAAMPGGAHAAGAA

Seg: seg
94-108 seg

PAAAAHGPAVAKHAG

HMMPanther: PTHR24057
117-477 FAMILY NOT NAMED,GLYCOGEN SYNTHASE KINASE-3 ALPHA

VTGHIISTTIGGKNGEPKKTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTT

Gene3D: G3DSA:3.30.200.20
134-214 no description

KKTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVM

superfamily: SSF56112
IPR011009
138-454 Protein kinase-like (PK-like)
Protein kinase-like domain

SYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFFDELREPHARLPNGRPFPPLFNFKQELANASP

ProfileScan: PS50011
IPR000719
139-423 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFF

HMMSmart: SM00219
IPR020635
139-423 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFF

HMMSmart: SM00220
IPR002290
139-423 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFF

HMMPfam: PF00069
IPR017442
142-423 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFF

PatternScan: PS00107
IPR017441
145-169 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGTGSFGIVFQAKCLETGETVAIKK

Gene3D: G3DSA:1.10.510.10
215-429 no description

EFVPESLYRVLKHYSNMNQRMPLIYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKICDFGSAKMLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAHPFFDELREP

PatternScan: PS00108
IPR008271
260-272 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDVKPQNLLV

Seg: seg
469-479 seg

LGLTLLPTTGP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox