PRGDB00064021 (Zm.19959)

From PRG Wiki
Jump to: navigation, search
Zm.19959
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219888214 (BT055875)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0002B23 mRNA, complete cds

DNA Sequence

CGTGCTCCTCCCGTCACCCTCGTCTCCACTCCCCGTGACGACCAGGAAGGAATTCTTCCTCCGTCCCCGTTCGCCCCGTCGTCTCGTCGTTTTCTCACCTGCGTGCTGCGTTCGCGGACAAAGTGTGGGAAAATGAAAACCTGAGCGCAAACAAACACTCTGAGCCTCGcaggagggagaggggggagagcggaggagAAACCACCTTTCTTTCCGTTCCAGACAAGCTCCCAGCTTTGAccgccgccgccgccgccgctgtgtgtgtgtgCTCCCTTAGTAGTTAGTCCCTGTCGCGTCCCGGATCGGAGCTCCCCTCCGTGCACGGGACACCGCCGGTCCGGGCGTCTCCACTCCCCCCCGGATCGATCAGCTCCGCCTCCGCAAGATAGGCAAGCAATGAGGTGCCTGCCTTTCTTGCATGGAGACACCAAAGAGAAGGATCCAGTCACTAAGTCGGCCTCTCTACGGTCCATGAGCACAACATCAACGGAGCGCGATGTCCGCTCCGGTTCAGACTTCACCTCCTTGAATGTTTCCGACATGAGCGCCGAGTCGATAAGGAGGACGCAGTACCCCAGCTTCACTGACCGCCCGTCTAACCTGAGGGTGTTCTCCTTTGCTGAACTGAAGAGTGCCACCCGCAACTTCAGCCGGTCTCTCATGGTTGGCGAGGGTGGCTTTGGCTGTGTGTACAGGGGTGTCATCAAGACCTCCGATGAACCGAACGAACGAATTGAGATCGCTGTTAAGCAGTTGAATCGTAAAGGACTTCAGGGGCAGAAGGAGTGGTTAACAGAGATGAATGTGCTTGGAATTGTGGATCATCCAAACCTAGTTAAACTTATAGGCTACTGTGCTGAAGATGATGAGAGGGGAGTACAACGGCTTTTAGTGTACGAATATATGCCTAATGGAAGTGTGGATGATCACTTGTCGAGTAGGTCAACTTCTACTCTGTCATGGCCAATGAGACTAAAAGTAGCTCTTGATTCTGCTCGGGGACTGAAGTATCTGCATGAAGAAATGGAATTCCAGGTTATTTTCCGGGACCTGAAAACATCTAACATTTTGTTGGATGAGAACTGGAATGCTAAACTGTCAGACTTTGGTTTGGCTAGGCATGGACCAGCAGAAGGTCTGACCCATGTCTCCACAGCGGTGGTCGGGACTCTAGGCTACGCAGCTCCAGAGTACATGCAGACTGGGCGCCTGACCGCGAAGAGCGACATATGGAGCTACGGCGTCCTCCTGTACGAGCTGATCACAGGCCGCCGCCCCATCGACCGGAACCGCCCAAAGAGCGAGCAGAAGCTCCTGGACTGGGTGAAGCCGTACATCTCGGACGTGAAACGGTTCCCCATCATCGTCGACCCGCGGCTGGAGGGGCACTACAACCTCAAGTCCATGACGAAGCTGTCCAGTGTGGCGAACCGGTGCCTGGTCCGGATGCCCAAGTCTCGCCCCAAGATGAGCGAGGTGTACGACATGGTGCAGAAGATCGTGGACTGCGTGGGGACCGGCCCGCCGCAGCCCCCGCTGCTGCACTACCACGGCTCGGCCTCTGAGCCTGGCCCTGGCGACAAGCGCGCCAGGAAAGGGTCGGTGAAGAGGAGGAGGCTCTGGGAGCTCAGGTTCGGCTGCCGGCACATCGTGTGGCGCGGCTGGAAGCCTGCGATCGTGAAGGACATCTGAGGAGGGCGGGGTGGCTCCGGTGCTGTAAGTACAGTAGCTAGCTAGCTGTTCATAGAGACGGTGGTAACAGTTTGTTCCACCGTGTAGTGCTTGGTTGGTATATAGGGTGAGTTCATGCTTGCATAATACCAGTCGagaagaagaagaagaaAGGTGCACAGTTGAGTGGGGTGGCGTTGGAATGGAGTACATAGAGTAGTGCTGTGTGTAATTTCCAGTGCAACTTCTGCTGCTGGCTTTCTTCGTCTTTGGGACAAGTTTGGTGTGGTCTTCGGGGATGATTCAGATACCC


Protein sequences

Name Description Sequence
Zm.19959 translated coding region predicted by ESTScan from UniGene Zm.19959

MRCLPFLHGDTKEKDPVTKSASLRSMSTTSTERDVRSGSDFTSLNVSDMSAESIRRTQYPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVDCVGTGPPQPPLLHYHGSASEPGPGDKRARKGSVKRRRLWELRFGCRHIVWRGWKPAIVKDI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF641
8-392 PTHR24420:SF641

HGDTKEKDPVTKSASLRSMSTTSTERDVRSGSDFTSLNVSDMSAESIRRTQYPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVDCVGTGPPQPPLLHYHGSASEPG

HMMPanther: PTHR24420
8-392 PTHR24420,FAMILY NOT NAMED

HGDTKEKDPVTKSASLRSMSTTSTERDVRSGSDFTSLNVSDMSAESIRRTQYPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIVDCVGTGPPQPPLLHYHGSASEPG

superfamily: SSF56112
IPR011009
54-365 Kinase_like
Protein kinase-like domain

IRRTQYPSFTDRPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMV

Gene3D: G3DSA:3.30.200.20
65-170 G3DSA:3.30.200.20

RPSNLRVFSFAELKSATRNFSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYM

ProfileScan: PS50011
IPR000719
84-369 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRSLMVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMVQKIV

HMMPfam: PF00069
IPR017442
89-362 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

MVGEGGFGCVYRGVIKTSDEPNERIEIAVKQLNRKGLQGQKEWLTEMNVLGIVDHPNLVKLIGYCAEDDERGVQRLLVYEYMPNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVY

PatternScan: PS00107
IPR017441
90-118 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGGFGCVYRGVIKTSDEPNERIEIAVK

Gene3D: G3DSA:1.10.510.10
171-365 G3DSA:1.10.510.10

PNGSVDDHLSSRSTSTLSWPMRLKVALDSARGLKYLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPAEGLTHVSTAVVGTLGYAAPEYMQTGRLTAKSDIWSYGVLLYELITGRRPIDRNRPKSEQKLLDWVKPYISDVKRFPIIVDPRLEGHYNLKSMTKLSSVANRCLVRMPKSRPKMSEVYDMV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox