PRGDB00064024 (Zm.20043)

From PRG Wiki
Jump to: navigation, search
Zm.20043
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223949088 (BT063931)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0120O06 mRNA, complete cds

DNA Sequence

CCACTCTTGGCGAAGCGAAATCCACCGTACACCGCTGCCTCCCTCTCCCTGTCTCGTCTCGTCGAACCAGCCGAGGAAGCCAACGCAGACCCAGCGATCCTCGTCGCGCGCCCTCCTCCCCCACGGAGGGAAGGATGGCGGAGCCCAAAGCGGCGGCGGCGGCGAGGAAGACGCGGGTGGGCCCGTACGAGGTCGGCAAGACCATCGGCGAGGGCAGCTTCGCCAAGGTCAAGCACGCGCGCGACTCCCGCACCGGCGCCGTCCGCGCCATCAAGGTGCTCGACCGCAACCACGTCCTCCGCCACAGGATGGTCGAGCAGATCAAGCGGGAGATTTCGACTATGAAGCTGATCAAACATCCCAATGTGGTACAGCTGCATGAGGTTATGGCGAGCAAAACGAAGATATACATGGTTCTTGAATTTGTTGATGGAGGCGAGCTATTCGATAAGATCGTCAATTCTGGAAGGCTAGGAGAGGATGAAGCTAGGATATACTTTCATCAACTTATAAATGCAGTTGATTATTGCCATAGCCGAGGAGTGTACCATAGAGACCTGAAGCCAGAGAATTTGCTTCTGGATTCAAATGGAGCTCTTAAAGTTTCAGACTTCGGCCTAAGTGCATTTGCACCACAAACAAATGAGGATGGGCTTCTGCATACTACCTGTGGAACTCCAAACTATGTAGCACCTGAGGTGCTTGCTGATAAAGGTTATGATGGTATGGCTGCAGATGTATGGTCCTGTGGCATAATCTTATTTGTTCTTATGGCTGGATACTTACCCTTTGATGATGCCAATCTGATGAGACTGTACAAACTGATCTGCCAAGCATATTTTTCTTGCCCACCATGGTTTTCTTCTGGAGCGAAGAAGTTTATTAAGCGCATTCTCGATCCTAATCCTGATACGAGGATAACAATTGCAGAAATTTTGGAAGATGAATGGTTCAAAAAAGATTATAAACCACCACGTTTTGAACAAGGTGAAGATGTTAGCCTTGACGACATTGATGCTGCATTCAATGATTCAGAGGACCGTCTTGTGGCAGAGAAAAGAGAGAAACCGGAATCCATGAACGCGTTTGCTCTTATTTCGAGGTCGCAGGGTTTCAACCTTGGAAATTTGTTTGAGAAGGAGATGATGGGAATGGTAAAGAGGGAAACATCTTTCACGTCTCAATGCACAGCACAGGAGATCATGACAAAAATAGAGGATGCATGTGGGCCACTCGGTTTCAACGTGCGGAAACAAAATTACAAGATGAAATTGAAAGGTGACAAATCTGGAAGAAAAGGTCACTTATCTGTTGCAACTGAGGTTTTTGAGGTTGCCCCATCACTTCACATGGTTGAGCTTCGTAAAACCGGAGGAGACACATTGGAGTTCCACAGCTTCTACAAGAACTTCTCATCGGAGCTGAAAGATATCGTGTGGAAAGCTGAATCTGACGCAAATAATAAACAGACGAATAAGTGATACCCAGAGAATCTGTGTAGCCCTCATGAGGCCACATTCAGATAGATCACCTCTTCGGGTGATACCACCTGCTTGGTACTGTATGCttttttttttACTGGTACCACATTAGCAGCCAAAATCTCTTGTAAACGGGAACTCCTTCTGAATGAGCGCAATTGTACAAAACACATATGAAGAGGCCCTCCGTGAGATGCTCCGAACACTGCAATGGGATGTCAAATAGTTCTG


Protein sequences

Name Description Sequence
Zm.20043 translated coding region predicted by ESTScan from UniGene Zm.20043

XTLGEAKSTVHRCLPLPVSSRRTSRGSQRRPSDPRRAPSSPTEGRMAEPKAAAAARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEDVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTAQEIMTKIEDACGPLGFNVRKQNYKMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNKQTNK

Domains

Domain Start-End Description Sequence

Seg: seg
19-41 seg

SSRRTSRGSQRRPSDPRRAPSSP

superfamily: SSF56112
IPR011009
49-346 Protein kinase-like (PK-like)
Protein kinase-like domain

PKAAAAARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEDVSLDDIDAAFNDSE

Seg: seg
51-55 seg

AAAAA

Gene3D: G3DSA:3.30.200.20
55-170 no description

ARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQL

HMMPanther: PTHR24345:SF45
57-489 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK1

KTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEDVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTAQEIMTKIEDACGPLGFNVRKQNYKMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNK

HMMPanther: PTHR24345
57-489 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK

KTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEDVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTAQEIMTKIEDACGPLGFNVRKQNYKMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNK

HMMPfam: PF00069
IPR017442
63-318 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

ProfileScan: PS50011
IPR000719
63-318 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

HMMSmart: SM00220
IPR002290
63-318 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

HMMSmart: SM00219
IPR020635
63-317 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEW

PatternScan: PS00107
IPR017441
69-92 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSFAKVKHARDSRTGAVRAIK

Gene3D: G3DSA:1.10.510.10
171-325 no description

INAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPP

PatternScan: PS00108
IPR008271
182-194 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
355-379 NAF
NAF/FISL domain

EKPESMNAFALISRSQGFNLGNLFE

HMMPfam: PF03822
IPR004041
356-418 NAF
NAF domain

KPESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTAQEIMTKIEDACGPLGFNVRK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox