PRGDB00064025 (Zm.20465)

From PRG Wiki
Jump to: navigation, search
Zm.20465
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223947474 (BT063124)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0028D19 mRNA, complete cds

DNA Sequence

CAATTTAGCTAGTTCCAGGAACACGCGAGGAAACCGCAGGCATGGCCAACAACCGCATCTTCGACGAGTACAACCCCGCCGTCGAATGGAGCCGCTCCGACGAGGCCGATGCCGTCAGGATCTCGCTCCCAGGGTTCAAGAGGGAGGACATACGCGTGCTGGTGGACAGCCACGGCCACCTGCGGACGCGCGGCGAGCGGCACATCGCCGGCAACAGGTGGAGCCGCTTCCAGACGGACGTCGACCTCCCCGCCAACTGCAACGCCGACGGCATCCGCGCCAAGTTCGAGAACGACAGGCTCACCATCACGCTGCCCAAGAGCACCTCCTCGGCGCCCATTCCGGCGCCGCCGCAGAGGCCGCACGTGAAGGCGCCGTCGACGTCGTCGGAGAGGCTTCCGCCGGTGATTGCTAAGCCAGTGGCGAGGCCTGCCGCGCCGCGGCCCCTGGTGCCGCCAGCGGCGCCGCTGGCTCCTCCTCCTTCCGTGAAGCCGCCCGCCGAGCCCAGGCCGTCGATGCCGAAGAACCCGTACGCTTCCGTGCCGGCACCGGCACCAGCGCCGGCGCCGGCGCCGCAAGTGGAACAACCTGCAACCACCACCAAGCCCGCCGAGCCCAGGCCGTCGATGCCGAAGAACCCGTACGCTTCCGTGCCGGCACCGGCACCAGCGCCGGCGCCGGCGCCGCAAGTGGAACAGCCTGCAACCACCACCAAGCCCGCCGAGTCGTCGCTGGGGGCTGTtcagaggccgaaggagcaggaggacaggcagaggaagagggaggaagaggggaagatggctgaggacaggaaggagacggtgcaggagaAGGACACGGTCACGGAGCAGCACCAGCAGCAGGAGGAGAAGGCAATGCTGGCAGAGAAAGAGATGGCGTTCGCGAACCAGCCCGGGCCGGCCTTCGCGAGCCGCGGCCTGCTGATGAACGTGGCGATCGCCGTGGTGGTGCTCCTCGGGGTCACCGTCCACTTGTGGCTTAGCCTGAGGAACGCCACTGGAGGCGCCGGCGAGCACGGCCACGGCCCACGGGCAGATGGGGGCCGGTAGACATACGACCACGCGATGTGAACAGGGCTGACTCGAGCTGGGGCGTGAgtacactgtacacactacacaatacacgtacacagtacacTAAACTGAAAGGGGAAATGGGAAATAATCCAAGTACATACAAAAGAGGCGCGGTACAGTACATACTCGTATATGCATGCTGTTTGTTTATCATCTGGTTCCAATTCTATTATCGGCCTTGTTTATCT


Protein sequences

Name Description Sequence
Zm.20465 translated coding region predicted by ESTScan from UniGene Zm.20465

MANNRIFDEYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSAPIPAPPQRPHVKAPSTSSERLPPVIAKPVARPAAPRPLVPPAAPLAPPPSVKPPAEPRPSMPKNPYASVPAPAPAPAPAPQVEQPATTTKPAEPRPSMPKNPYASVPAPAPAPAPAPQVEQPATTTKPAESSLGAVQRPKEQEDRQRKREEEGKMAEDRKETVQEKDTVTEQHQQQEEKAMLAEKEMAFANQPGPAFASRGLLMNVAIAVVVLLGVTVHLWLSLRNATGGAGEHGHGPRADGGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11527
1-121 PTHR11527,SMALL HEAT-SHOCK PROTEIN (HSP20) FAMILY

MANNRIFDEYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSAPIPAPPQRPHVKAPSTSSERLPP

HMMPanther: PTHR11527:SF44
1-121 PTHR11527:SF44,SUBFAMILY NOT NAMED

MANNRIFDEYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSAPIPAPPQRPHVKAPSTSSERLPP

superfamily: SSF49764
IPR008978
2-110 HSP20_chap
HSP20-like chaperone

ANNRIFDEYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSAPIPAPPQRPHVK

Gene3D: G3DSA:2.60.40.790
9-98 G3DSA:2.60.40.790

EYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSA

ProfileScan: PS01031
IPR002068
15-93 HSP20
Heat shock protein Hsp20

EWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPK

HMMPfam: PF00011
IPR002068
16-97 HSP20
Heat shock protein Hsp20

WSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRWSRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox