PRGDB00064026 (Zm.20524)

From PRG Wiki
Jump to: navigation, search
Zm.20524
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194699877 (BT039018)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0351E15 mRNA, complete cds

DNA Sequence

CTGGAGGAGACGCTTCGGCATGCGTATGTCCTCATCACATCCTGTCGCAACAGCAGCTACCTATACAACTGCTGTATGGGAGGGAAGCAGGCTGATCGGCTTCGAGAGGTGCAGAATGAGATTACCTTCTACCTCCAACTTTTCCCCCTTGTCAGCTTTGTCGACAACACCCGTACTTGGGAGCGGCTTCTGAGTAGAGCTTGTCCTCTGTGCACAACAGAAAACATGGATGAGTTACATGCAGCAGCACATCATGTGGAACATGAAGATGGATCAGAGGCCATCAAGGCAACTAAATTCGAAAATCTCGGAAGTCATCCTACCCTAAAACCTGACATAGATCAAATGGAAGGCCAAGTCATGAGGATGGGAGGATTAGTAAATCTCATTGGTGGTACAAAAGGAGCAGAGTTATCATGTTTTACCTTTTCTCATATTTTGGCGGCGACAGACAACTTTTCAGAGAAAAATTTGGTTGGTAAGGGTGGATTTGGTTATGTCTACAAGGGCAATCTTATTAATGGTCTTAACGTTGCCATTAAAAGATTTGATGCATGTTCATCATATCAAGGTCCACATGAGTTCAGAACTGAGATTGATGCCATTCCAAATCTTCGACACAAGAACATAATTGGTCTACTTGGGTACTGTGTTCAAGGAGAAGAAAGCATACTTGTCTATGAATATATGTCAAATAAATGCTTGGCATCTGTCATTGCTGGCAAGTTTTTGTTGACTTAATGCCTCTTTCCTCTTTTCTGATCATTGTTCAGCAAGTACTACCCACATATTTCTGCTACAAACGCATTGATGGTTTTTGTAGATGAAACAAAAAGGGGGTTGCTAAATTGGTCCAAGCGTCTTCAAATAATCAAAGGCATAGCAGATGGTCTTGCTTTTCTGCATGGGCATTCTCAGATGTGCATTGTCCACAGGGACATAAAACCAAGCAACATCCTGCTGGACCATGAAATGAATGCCAAGATTACTGATTTTGGTCTGGCATTAATGTTGGCTCCAAAATCGACTGCAGAGGTTCCTGTTTTGGGCACATATGGCTATGCAGATCCTGAATATATTGTTACTGGAAAAATCTCGGAGAAGGCAGACATATATGGATTTGGCATAGTACTTTTTGAGATAATAAGTGGAAGGTCGATCCATTCTTATATGAAGGCAGAGGGCACTCGAGAGCTACCATACCCTGCTTATGCACACAAATACAACCCAAAGACGCTGCACAAGCTTGTTGATCCATTGTTGCGCGTGGACGAGCATGAACGGGCTCAGATTATGGAATGCGTGAGGGTGGCGCAGTTATGCGTTGACCATCGTGCCAAGCATCGGCCTGTGATGTCAGAAGTTGTCACCATGCTTGGCATGGCAGCATCAAAGGGATAGTTGTAGCTTTGCAAGACCCACAAAGGGATAGCTGTGAATGATGCAAGTGTGAACTAATTAATGAGCTCTACTCAACTATTTTCCCCCTTCTCATGCATGATTGTGTAAACATCAGGGAGATTAGTCAGTGAAATATTTGGCATGCACCTTACTTGAGCGCTGTGGCTAATAAATTGTGGTTGGCTGG


Protein sequences

Name Description Sequence
Zm.20524 translated coding region predicted by ESTScan from UniGene Zm.20524

LEETLRHAYVLITSCRNSSYLYNCCMGGKQADRLREVQNEITFYLQLFPLVSFVDNTRTWERLLSRACPLCTTENMDELHAAAHHVEHEDGSEAIKATKFENLGSHPTLKPDIDQMEGQVMRMGGLVNLIGGTKGAELSCFTFSHILAATDNFSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHRAKHRPVMSEVVTMLGMAASKG

Domains

Domain Start-End Description Sequence

Seg: seg
80-85 seg

HAAAHH

Gene3D: G3DSA:3.30.200.20
137-217 no description

ELSCFTFSHILAATDNFSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYC

HMMPanther: PTHR24420
141-459 FAMILY NOT NAMED,FAMILY NOT NAMED

FTFSHILAATDNFSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHRAKHRPVMSEVVTML

superfamily: SSF56112
IPR011009
142-459 Protein kinase-like (PK-like)
Protein kinase-like domain

TFSHILAATDNFSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHRAKHRPVMSEVVTML

ProfileScan: PS50011
IPR000719
153-461 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHRAKHRPVMSEVVTMLGM

HMMSmart: SM00219
IPR020635
153-459 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHRAKHRPVMSEVVTML

HMMSmart: SM00220
IPR002290
153-440 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQL

HMMPfam: PF00069
IPR017442
155-435 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKNLVGKGGFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEESILVYEYMSNKCLASVIAGKFLLTXCLFPLFXSLFSKYYPHISATNALMVFVDETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECV

PatternScan: PS00107
IPR017441
159-181 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGGFGYVYKGNLINGLNVAIK

Seg: seg
159-170 seg

VGKGGFGYVYKG

Seg: seg
243-257 seg

FLLTXCLFPLFXSLF

Gene3D: G3DSA:1.10.510.10
281-445 no description

LLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKPSNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGIVLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVRVAQLCVDHR

PatternScan: PS00108
IPR008271
309-321 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox