PRGDB00064027 (Zm.20866)

From PRG Wiki
Jump to: navigation, search
Zm.20866
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195615937 (EU957681)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1603794 receptor protein kinase CLAVATA1 precursor, mRNA, complete cds

DNA Sequence

ATGCACTCCTGCGCAGTCGACGGCAGCTCGCTCGCTAAGTCGCTAGTAAAGTTGACGCCGCCGACACTCGGCTCCACTTCCACTGGTCTACACTCCACTCACCAGCTCCCATCCGTCGTCCATGGCCGCCGCCACCTGCCTCCCTCTCTTCGTCCTCGTTTCAGTACTGATGGCCGCCTCGACCTCGCCGTCTTCGGCGGCAGAGACGCCGCAGGAGCTGCTGCTCGACTTCAAGGCGTCCCTGCAGGACCCGTCGGGCGCTCTCTCCGCCTGGTCGAGCTCCACGCCCTACTGCAACTGGCCGCACGTCGCCTGCGCCATCAGCGCCGCCGCGAACGCGACCGTCTCGGTCTCCATCTCGCTCCAGGGCCTCGGCCTCTCGGGCGACCTCGCCGCCTCCTCCCTCTGCCGCGTGCGGGGCCTGATCGCGCTGAGCCTCGCGTCCAACGGCTTCAACCAGACCATCCCGCTGGAGCCGTCGCGCTGCGCCTCGCTCGCGTCGCTCAACCTCAGCGCCGGCGCCTTCTGGGGCCCGCTCCCCGAGCAGCTGGCCATGCTCACCTCGCTCGTGTCGCTCGACCTCAGCCGCAACAGCTTCGAGGGCCAGGTGCCCGCCGGCCTCGCCGCGCTCGGCGGCCTCCAGGTGCTCGACCTCGGGGAGAACCTGCTCTCCGGCGTGCTCCACCCGGCGCTGTTCGGCAACCTCACCAGCCTGCACCTCCTGGACCTGTCCAGGAACCAGTTCCTCGACTCCGAGCTGCCGCGGGAGCTCGGCAGGATGAGCAGCCTCAGGTGGCTGTTCCTGCAGGGCTCGGGGTTCAGCGGCGTCATCCCGGAATCCTTCCTCGGGCTGGAGCAGCTGGAGGCTCTTGACCTGTCCATGAACAACCTGGCCGGCGTCGTGCCTCCCGGGTTCGGCCTCAGGTTGCAGAAGCTGATGACTCTGGATTTGTCACAGAACGGCCTCTCCGGGCAGTTGCCGGAGGAGATCGCTAGCTGCTCGATGCTTCGGAGGTTCGAGGTCCACGACAACGCCTTCAGCGGGGAGCTGCCTGCCGGGCTCTGGTCGCTGCCGGACCTACGCGTCATCCGGGCCCAGAACAACCGGTTCACCGGACGCCTGCGCGAGTTCCCAGGCGGCCAGTCTCGGCTCGAGCAGGTTCAGATTGACAACAACAGCTTCTCCGGCGGGATACCTCAGAGCATCGGCCTGGTCCGCACCATGTACCGTTTCTCCGCCTCCCTCAACGAGCTCAACGGCAGCTTGCCGGACAACCTCTGCGACTCTCCCGCGATGAGCATCATCAACATCTCCCGCAACGCGCTCTCCGGCACGATCCCGGCGTTCAAGAACTGCAGGAGGCTGGTGTCGCTGTACCTGGCCGGCAACGGCTTCACCGGGCCTATACCGGCGTCCCTCGGAGACTTACAGGTGCTGACGTACATCGACCTGTCCAGCAACGCCCTCACCGGCGGCATTCCGACGGAGCTCCAGAACCTGAAGCTCGCCCTGCTGAATGTCTCGTACAACCAGCTCTCCGGCCGCGTGCCGCCATCTCTGATCACCGAGCTTCCCGCCGTGTTCCTCCAGGGCAACCCGGGGCTGTGCGGCCCGGGGTTGCCGAAAGACTGCGACGCCGACGCGCCATCGCGGAGGCGTCAGGGACTCGCGGTGGCCGCAACCGTGGCGTCGTTTCTCACCGGCGTGGCGCTGCTCGCTGTCGGGGCATTCGCGGTCTGCAAGAGGTTACGCGGCAGCGAGtcctcctcctcctcctccCCGTGGAAGCTCGTGCTCTTTCACCCTGTCAGAATCACCGGAGAGGAGCTGCTCGCTGGATTCCACGACAAGAATATCATCGGCAGAGGTGCCTTTGGAAGAGTTTACCTGATCGAGCTCCAAGACGGGCAAAAGGTTGCGGTGAAGAGGCTGGTGAACTCGTCAGGCAAGCTAACATTCAGAGTAGCCAAGAACGAGATGGAAGCACTGGCGAAAATCCGCCACAAGAACATCGCCAAGGTGCTGGGATTCTTCTACTCCGGGTCCGACGGCGAGGTCAGCATCATATATGACCACTCGCAGTCGCAGGTAGGAAGCTTGCAGGATCTCATCTGCGCGCCGAAACTCACAATCTGCTGGAAGGACCGGGTGAGGATCGCTCTGGGAGTAGCTCAAGGGCTGGCACACCTTCACCATGACCATGCTCCTCAAGTGCTGCATAGAGACCTCAAGTCGAGCAATGTGCTGCTACTCGGTGATGAACTCGAGCCCAGGGTCACCGGGTTTGGGATTGATCGTGTTGTCGGGGAGATGGCGTACCAGTCTTGCATGTCTTCGGACCTGAATTACAAGTGCTATGTTGCACCAGAGCAAAGCTGCACCAAGAAACCAACGCACCTCATGGACGTCTACAGCTTCGGGGTCATCCTACTGGAACTGGTCACCGCAGCACAGCGGCCGGCGTCCGACGGCGAGTCCGTCGACGTCGTCAAGTGGGTGCGGCGGCGGGCCAACGTGACCGACGGAGTGTCGCAGATACTTGACCCCAGCATCGCCAGCGCGGCGACGCAGAAGGGGATGCAGGCCACCCTCGAGCTCGCCCTGCGCTGCACGTCAGTGGTGCCCGATCGGAGACCGGCCATGGATGAGGTTGCCCGGTCGCTGCAGGCAATCAGTTTCGCTAGTGTTCATCCGCAGACGCCGATGCTCACTAAATCGCCCGGGACTCTGGAACCATGAATGGCACTGGTGTGGTGTGGTGGCGGCGTAGCGTAAGGGTTCACAGTATCCATTACCGCGTAGGCGCATAGCCCTTCCTTCTTGTAGTTGTACATACATGGTAATAATAAAGAGAAATAAATGGTCAGCGTGGATTAGAAGCTTATTCTGCaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.20866 translated coding region predicted by ESTScan from UniGene Zm.20866

MHSCAVDGSSLAKSLVKLTPPTLGSTSTGLHSTHQLPSVVHGRRHLPPSLRPRFSTDGRLDLAVFGGRDAAGAAARLQGVPAGPVGRSLRLVELHALLQLAARRLRHQRRRERDRLGLHLAPGPRPLGRPRRLLPLPRAGPDRAEPRVQRLQPDHPAGAVALRLARVAQPQRRRLLGPAPRAAGHAHLARVARPQPQQLRGPGARRPRRARRPPGARPRGEPALRRAPPGAVRQPHQPAPPGPVQEPVPRLRAAAGARQDEQPQVAVPAGLGFSGVIPESFLGLEQLEALDLSMNNLAGVVPPGFGLRLQKLMTLDLSQNGLSGQLPEEIASCSMLRRFEVHDNAFSGELPAGLWSLPDLRVIRAQNNRFTGRLREFPGGQSRLEQVQIDNNSFSGGIPQSIGLVRTMYRFSASLNELNGSLPDNLCDSPAMSIINISRNALSGTIPAFKNCRRLVSLYLAGNGFTGPIPASLGDLQVLTYIDLSSNALTGGIPTELQNLKLALLNVSYNQLSGRVPPSLITELPAVFLQGNPGLCGPGLPKDCDADAPSRRRQGLAVAATVASFLTGVALLAVGAFAVCKRLRGSESSSSSSPWKLVLFHPVRITGEELLAGFHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAISFASVHPQTPMLTKSPGTLEP

Domains

Domain Start-End Description Sequence

Seg: seg
22-34 seg

TLGSTSTGLHSTH

Seg: seg
63-82 seg

AVFGGRDAAGAAARLQGVPA

Seg: seg
94-144 seg

LHALLQLAARRLRHQRRRERDRLGLHLAPGPRPLGRPRRLLPLPRAGPDRA

Seg: seg
159-168 seg

AVALRLARVA

Seg: seg
169-184 seg

QPQRRRLLGPAPRAAG

Seg: seg
192-231 seg

ARPQPQQLRGPGARRPRRARRPPGARPRGEPALRRAPPGA

Seg: seg
232-249 seg

VRQPHQPAPPGPVQEPVP

HMMPanther: PTHR24420
270-900 FAMILY NOT NAMED,FAMILY NOT NAMED

GLGFSGVIPESFLGLEQLEALDLSMNNLAGVVPPGFGLRLQKLMTLDLSQNGLSGQLPEEIASCSMLRRFEVHDNAFSGELPAGLWSLPDLRVIRAQNNRFTGRLREFPGGQSRLEQVQIDNNSFSGGIPQSIGLVRTMYRFSASLNELNGSLPDNLCDSPAMSIINISRNALSGTIPAFKNCRRLVSLYLAGNGFTGPIPASLGDLQVLTYIDLSSNALTGGIPTELQNLKLALLNVSYNQLSGRVPPSLITELPAVFLQGNPGLCGPGLPKDCDADAPSRRRQGLAVAATVASFLTGVALLAVGAFAVCKRLRGSESSSSSSPWKLVLFHPVRITGEELLAGFHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAISFASVHPQT

HMMPanther: PTHR24420:SF84
270-900 OS04G0472500 PROTEIN,OS04G0472500 PROTEIN

GLGFSGVIPESFLGLEQLEALDLSMNNLAGVVPPGFGLRLQKLMTLDLSQNGLSGQLPEEIASCSMLRRFEVHDNAFSGELPAGLWSLPDLRVIRAQNNRFTGRLREFPGGQSRLEQVQIDNNSFSGGIPQSIGLVRTMYRFSASLNELNGSLPDNLCDSPAMSIINISRNALSGTIPAFKNCRRLVSLYLAGNGFTGPIPASLGDLQVLTYIDLSSNALTGGIPTELQNLKLALLNVSYNQLSGRVPPSLITELPAVFLQGNPGLCGPGLPKDCDADAPSRRRQGLAVAATVASFLTGVALLAVGAFAVCKRLRGSESSSSSSPWKLVLFHPVRITGEELLAGFHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAISFASVHPQT

Gene3D: G3DSA:3.80.10.10
273-537 no description

FSGVIPESFLGLEQLEALDLSMNNLAGVVPPGFGLRLQKLMTLDLSQNGLSGQLPEEIASCSMLRRFEVHDNAFSGELPAGLWSLPDLRVIRAQNNRFTGRLREFPGGQSRLEQVQIDNNSFSGGIPQSIGLVRTMYRFSASLNELNGSLPDNLCDSPAMSIINISRNALSGTIPAFKNCRRLVSLYLAGNGFTGPIPASLGDLQVLTYIDLSSNALTGGIPTELQNLKLALLNVSYNQLSGRVPPSLITELPAVFLQGNPGLCG

superfamily: SSF52058
273-544 L domain-like,LRR

FSGVIPESFLGLEQLEALDLSMNNLAGVVPPGFGLRLQKLMTLDLSQNGLSGQLPEEIASCSMLRRFEVHDNAFSGELPAGLWSLPDLRVIRAQNNRFTGRLREFPGGQSRLEQVQIDNNSFSGGIPQSIGLVRTMYRFSASLNELNGSLPDNLCDSPAMSIINISRNALSGTIPAFKNCRRLVSLYLAGNGFTGPIPASLGDLQVLTYIDLSSNALTGGIPTELQNLKLALLNVSYNQLSGRVPPSLITELPAVFLQGNPGLCGPGLPKDC

HMMPfam: PF13516
309-331 LRR_6,Leucine Rich repeat

LQKLMTLDLSQNGLSGQLPEEIA

Gene3D: G3DSA:2.60.120.200
IPR013320
554-634 no description
Concanavalin A-like lectin/glucanase, subgroup

QGLAVAATVASFLTGVALLAVGAFAVCKRLRGSESSSSSSPWKLVLFHPVRITGEELLAGFHDKNIIGRGAFGRVYLIELQ

Seg: seg
565-579 seg

FLTGVALLAVGAFAV

Seg: seg
586-593 seg

SESSSSSS

superfamily: SSF56112
IPR011009
586-911 Protein kinase-like (PK-like)
Protein kinase-like domain

SESSSSSSPWKLVLFHPVRITGEELLAGFHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAISFASVHPQTPMLTKSPGTLE

ProfileScan: PS50011
IPR000719
614-900 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAISFASVHPQT

HMMSmart: SM00219
IPR020635
614-888 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSL

HMMSmart: SM00220
IPR002290
614-891 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQAI

HMMPfam: PF00069
IPR017442
615-885 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HDKNIIGRGAFGRVYLIELQDGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYDHSQSQVGSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVA

PatternScan: PS00107
IPR017441
620-642 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGAFGRVYLIELQDGQKVAVK

Gene3D: G3DSA:3.30.200.20
635-691 no description

DGQKVAVKRLVNSSGKLTFRVAKNEMEALAKIRHKNIAKVLGFFYSGSDGEVSIIYD

Gene3D: G3DSA:1.10.510.10
698-889 no description

GSLQDLICAPKLTICWKDRVRIALGVAQGLAHLHHDHAPQVLHRDLKSSNVLLLGDELEPRVTGFGIDRVVGEMAYQSCMSSDLNYKCYVAPEQSCTKKPTHLMDVYSFGVILLELVTAAQRPASDGESVDVVKWVRRRANVTDGVSQILDPSIASAATQKGMQATLELALRCTSVVPDRRPAMDEVARSLQ

PatternScan: PS00108
IPR008271
738-750 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox