PRGDB00064028 (Zm.20975)

From PRG Wiki
Jump to: navigation, search
Zm.20975
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194698319 (BT038239)
Gene Class RLP
Domain Type Ser-Thr Kinase, Receptor-Like Kinase, LRR
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0220K08 mRNA, complete cds

DNA Sequence

TTTCTCTTTCCACCGGTCCCCGAGCTGCAGCACAAGAAGCGATTCCAGCTGTTGTCTTGCATCTCCCTTGTGCTATCTCACCCCATGTTCGCACAGGAAACTGAAGAAGAGGGGTCAGGGCACAGACCGCTTCACGCAGCAGCCCGCCCGCGGTCGCGCGTGCAAAAGGAGCGCACTTGCGAAATGAGCTAGAAGATGGCGATTTAGTGGAGGCGAAAAGCTGCGATGGGGCTGGGTCGTCGATGGAGAAGTGCTGGCAGCGTGCCCTAGCTCTGGGATTTATCTTACAACAAGTTGAGCGGATCAATACCTGATTCCCTGCCAACTTTGCCTTCCCTACGAGTTCTAAATGTATCTGGCAACCAGCTGAGTGACGAATCCCTATGTAAAAATTATACTGGACCACTTATTTTCAGACGTGATTTTGATGGCTCAGTATGCAACAAACCTTCACCCAGCCCGTCAAGAAATAAAGTAGCTATCATAGCTATTTCAGTAGTGGTTCCTGTGTTAGTACTAATTGTACTACTTCTTACATATTTCATCTGGTGGCAGAAAAGAAAGCCTATTGTGCAACCAGTACCCACACATGGCTCAACAAGAGATCCAGAACCTGATAATGCTTCAGGAATCAAAAAAAGTTATGGCTACAACCTGAATATAACTGAGAATCGTCAGTTCACATACAAAGAGCTGGAGAAGTTCACTAATAATTTCAAGAAGTTCATAGGACAAGGAGGTTTTGGGCCCGTCTACTATGGCCGTTTGGAAGATGACACTGAGGTTGCTGTCAAGATGCGTTCTGAATCATCGTCACATGGGCTTGATGAATTTTTAGCTGAGGTTCAGAGCTTGACAAAGGTGCATCACAGGAATCTAGTGTCTTTGATTGGTTACTGCTGGGAGGAAGATCATTTGGCGCTGGTTTATGAGTACATGCCTCAGGGCAGTCTTTTTGATCATCTGAGAGGTAAAAATGGTGTTTCTGAAGCCTTGAATTGGAGGAAACGTGTACAGGTAGTGCTTGAAGCTGCACAAGGTCTGGATTATCTGCACAAGGGTTGCAGTTTGCCAATAGTCCACCGTGATGTGAAGACCAACAACATTCTCTTGGGTCAAAATCTGCAAGCTAAAATAGCAGATTTTGGACTTTCCAAGACATATCTGAGCGACACACAAACTCACATATCAGTCACTCCAGCTGGCACAGCTGGTTACATGGACCCTGAGTACTACCAGACCGGAAGGCTCAGTGAGAGCAGCGACGTGTTCAGCTTCGGAGTTGTTCTGCTTGAGGTAGCCACAGGCGAGTCCCCGACATTGCCAGGCCAAGGTCACATCAATCAGCGCGTTAAACAGAAGATTGCCACTGGCAACGTTGGCTCGATCGCTGATTCGCGACTTGGAAGCGCCTACGACATCAGCTCCATGTGGAAGGTAATCGACACCGCTGTGATGTGCACGGCGGACTCTACTGCTCAGAGGCCAACGATGGCCACAGTTGTGATACAGCTGAAGGAGAGCCTGGCGTTGGAGGAAACTCGTGAAAAGGGAAGTAGCAACAGGGTGAGCCGAGGGAGTGATGTAGAAGCTATGGCGTCCACACTTGGTCCATTCGCAAGATGAAGCTGTGCCTGTACCTGGATTCAGTTCATGGTTGACGCTCGTGAACTCCTTGTCATGTGAAGACAACTAGTAGCGTATAATTGTGGGCTGTTTTGAACCAGCAATTGCTTGTGTGTGTATGGACTTTGACAAAGGTTTGGTGTGAGCTTGCAGCTTCTCCAGAATCCAGATGTCATGCTCTGTATGTATCTTTGACAAAGATTTCCCGTGTCTATATATAACTGCATGGTACTAATAACATAAAGGATTGACTTTGTTTG


Protein sequences

Name Description Sequence
Zm.20975 translated coding region predicted by ESTScan from UniGene Zm.20975

XSLSTGPRAAAQEAIPAVVLHLPCAISPHVRTGNXRRGVRAQTASRSSPPAVARAKGAHLRNELEDGDLVEAKSCDGAGSSMEKCWQRALAWDLSYNKLSGSIPDSLPTLPSLRVLNVSGNQLSDESLCKNYTGPLIFRRDFDGSVCNKPSPSPSRNKVAIIAISVVVPVLVLIVLLLTYFIWWQKRKPIVQPVPTHGSTRDPEPDNASGIKKSYGYNLNITENRQFTYKELEKFTNNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQLKESLALEETREKGSSNRVSRGSDVEAMASTLGPFARXSCACTWIQFMVDARELLVM

Domains

Domain Start-End Description Sequence

Seg: seg
44-55 seg

ASRSSPPAVARA

Gene3D: G3DSA:3.80.10.10
93-124 no description

DLSYNKLSGSIPDSLPTLPSLRVLNVSGNQLS

superfamily: SSF52058
93-126 L domain-like,LRR

DLSYNKLSGSIPDSLPTLPSLRVLNVSGNQLSDE

HMMPanther: PTHR24420:SF417
93-535 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DLSYNKLSGSIPDSLPTLPSLRVLNVSGNQLSDESLCKNYTGPLIFRRDFDGSVCNKPSPSPSRNKVAIIAISVVVPVLVLIVLLLTYFIWWQKRKPIVQPVPTHGSTRDPEPDNASGIKKSYGYNLNITENRQFTYKELEKFTNNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQLKESLALEETREKGSSNRVSRGSDVEAMAST

HMMPanther: PTHR24420
93-535 FAMILY NOT NAMED,FAMILY NOT NAMED

DLSYNKLSGSIPDSLPTLPSLRVLNVSGNQLSDESLCKNYTGPLIFRRDFDGSVCNKPSPSPSRNKVAIIAISVVVPVLVLIVLLLTYFIWWQKRKPIVQPVPTHGSTRDPEPDNASGIKKSYGYNLNITENRQFTYKELEKFTNNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQLKESLALEETREKGSSNRVSRGSDVEAMAST

Seg: seg
159-178 seg

VAIIAISVVVPVLVLIVLLL

superfamily: SSF56112
IPR011009
209-505 Protein kinase-like (PK-like)
Protein kinase-like domain

SGIKKSYGYNLNITENRQFTYKELEKFTNNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQL

Gene3D: G3DSA:3.30.200.20
223-299 no description

ENRQFTYKELEKFTNNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGY

ProfileScan: PS50011
IPR000719
237-509 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQLKESL

HMMSmart: SM00220
IPR002290
237-498 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTM

HMMSmart: SM00219
IPR020635
237-505 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NNFKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQL

HMMPfam: PF07714
IPR001245
239-504 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FKKFIGQGGFGPVYYGRLEDDTEVAVKMRSESSSHGLDEFLAEVQSLTKVHHRNLVSLIGYCWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQ

Gene3D: G3DSA:1.10.510.10
300-518 no description

CWEEDHLALVYEYMPQGSLFDHLRGKNGVSEALNWRKRVQVVLEAAQGLDYLHKGCSLPIVHRDVKTNNILLGQNLQAKIADFGLSKTYLSDTQTHISVTPAGTAGYMDPEYYQTGRLSESSDVFSFGVVLLEVATGESPTLPGQGHINQRVKQKIATGNVGSIADSRLGSAYDISSMWKVIDTAVMCTADSTAQRPTMATVVIQLKESLALEETREKG

PatternScan: PS00108
IPR008271
359-371 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKTNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox