PRGDB00064032 (Zm.21277)

From PRG Wiki
Jump to: navigation, search
Zm.21277
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614119 (EU956772)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 1573329 disulfide oxidoreductase

DNA Sequence

AACACAACCCGCCCATTGCATTGCATCTTCCTCCTCCCGGCCCTTGCTCTTCCACTTCGTTGCGCCCATCCGTCTCTCGTCTCGTGCTCCCATCGTCGACCCATCACATATCCACACACAAGCTACCCTACGACGTATACAGAGAGAGGAAAAAGACTAGTGGTACGGCCGTCGCTAGCTCGACTAGTGATCCGATCCATCGATGGAGGCAGCAGACGCATCGTCAGCGCCGCCGCCTGCGGAAGGTCGGGTGGTGTGGGTGAACGGGCCCATCGTGGTGGGCGCGGGGCCGGGGGGCCTGTCGGTGGCGGCGTGCCTGCGGGCGCGCGGTGTTCCGTGCGTGGTGCTCGACCGCGCAGACTGCATCGCGTCGCTTTGGCAACGCCGCACCTACGACCGCCTCCGCCTGCACCTGCCGCGCCAGTTCTGCGAGCTCCCCGGGATGCCCTTCCCCGACCACTACCCGGAGTACCCCACCAAGCGCCAGTTCGTCGACTACCTCCAGGCCTACGCCGAGCGCGCGGGCGTCCAGCCGCGCTTCAACCAGGCCGTCACGTCCGCGCGCTACGACCGGGCcgcggggctctggcgcgtgcgcgccgccgacgctctcgccgacgacgacgtcgccagcgccgccTCCACCGAGTACATCGGCCGCTGGCTCGTCGTCGCCACGGGCGAGAACGCCGAGCGCATCGTGCCCGAGTTCGACGGCGCCCAGGACTTCGCCGGCCCCGTCTCCCACGTCTCCGAGTACAAGTGCGGCGAGGCGTACCGCGGCAAGCGCGTGCTCGTCGTCGGCTGCGGAAACTCCGGCATGGAGGTCTGCCTCGACCTCTGCGACCACAATGCCCTCCCGTCCATGGTCGTCAGGGACGCGGTGCACGTCCTGCCCCGGGAGATGTTCGGCGTCGCCACCTTCTCCGTGGCCGTCTTCCTGCTCCGCTTCCTGCCGCTCTGGCTGGTGGACGCCGTCCTCGTCCTGCTCGCGCGCCTCTTCCTCGGCGACCTGGAGAAGCTCGGCATCCGGCGCCCCGCCGGGGGCCCGCTCGAGCTCAAGAACGCCAGGGGCAGGACCCCCGTGCTGGACATCGGCGCCCTCGCCAGGATCCGCTCCGGCCACATACAGGTCGTGCCGGGGATCAAGAGGTTCTTCCGTGGCGGCGCCGAGCTCGTCGACGGCCGCCGCGTCGCTGCGGACGCGGTCATACTCGCCACCGGCTACCACAGCAACGTCCCTCAGTGGCTCAAGGGAAGTGATTTCTTCACGCAGGAAGGGTACCCAAGGGTGCCGTTCCCACACGGCTGGAAGGGGGAGTCCGGGCTCTACTCTGTTGGCTTCACCAGGAGAGGCCTCTCCGGCGTTTCCTCCGACGCTGTCAAGGTTGCGCAGGACATCGCCGTGGAATGGGAGAAGCAAACCTCCACAAGATGATGACGACCATGATGATGACGATGGATGCCCATCAACTTACCAGCTCACTCATGACCATCGTTGATCTCTCATGCATGGACCTGCTACGACGACCAACAGATCGATATCTTGCCATCATGCATAGCATGTTCAGCAAAAAGTGCAAAAACTTGAGATGATGTGGCCAAGAGTTGCCCCAAGCTCAAATCCAGAAACCAAAAGAAACAGAGGAGAAGCGCGCGTCGGGATCCAGATCCAAAACTGGAGAGCGAAGCGAGCCTCGTGGACGCTTGGGCGACAGGAAGAAGGCCGGACTGTGCGCGCGCGCGTCATGCAGAGCCCAGATTTTGCTGTACCCCATGGGCCCTTATATACATACATGCGTAGTTATGTACAGAGTGTTTTTATGTAGCAAAGTTGTGTACAGTAGTAGCAGTGCCTCTAGTGGGTTGGTAGAGTGTTAGCGTTGACATGCTTGTGTGTTTGTGTGCCATTGTCGTGATGTCTATGTATGGAGTTGACAACGAGAAATGACCTATTCTATTCaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.21277 translated coding region predicted by ESTScan from UniGene Zm.21277

MEAADASSAPPPAEGRVVWVNGPIVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVATFSVAVFLLRFLPLWLVDAVLVLLARLFLGDLEKLGIRRPAGGPLELKNARGRTPVLDIGALARIRSGHIQVVPGIKRFFRGGAELVDGRRVAADAVILATGYHSNVPQWLKGSDFFTQEGYPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEKQTSTR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
16-411 PTHR23023:SF5,MONOOXYGENASE

RVVWVNGPIVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVATFSVAVFLLRFLPLWLVDAVLVLLARLFLGDLEKLGIRRPAGGPLELKNARGRTPVLDIGALARIRSGHIQVVPGIKRFFRGGAELVDGRRVAADAVILATGYHSNVPQWLKGSDFFTQEGYPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEKQTSTR

HMMPanther: PTHR23023
16-411 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

RVVWVNGPIVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVATFSVAVFLLRFLPLWLVDAVLVLLARLFLGDLEKLGIRRPAGGPLELKNARGRTPVLDIGALARIRSGHIQVVPGIKRFFRGGAELVDGRRVAADAVILATGYHSNVPQWLKGSDFFTQEGYPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEKQTSTR

FPrintScan: PR00411
22-44 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

GPIVVGAGPGGLSVAACLRARGV

FPrintScan: PR00368
IPR013027
23-42 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIVVGAGPGGLSVAACLRAR

Gene3D: G3DSA:3.50.50.60
24-205 G3DSA:3.50.50.60

IVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNS

superfamily: SSF51905
24-312 SSF51905

IVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVATFSVAVFLLRFLPLWLVDAVLVLLARLFLGDLEKLGIRRPAGGPLELKNARGRTPVLDIGALARIRSGHIQVV

HMMPfam: PF13738
24-225 Pyr_redox_3,Pyridine nucleotide-disulphide oxidoreductase

IVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSARYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPVSHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVR

FPrintScan: PR00368
IPR013027
152-170 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

GRWLVVATGENAERIVPEF

FPrintScan: PR00411
155-164 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

LVVATGENAE

FPrintScan: PR00411
196-221 PNDRDTASEI,Pyridine nucleotide disulphide reductase class-I signature

RVLVVGCGNSGMEVCLDLCDHNALPS

FPrintScan: PR00368
IPR013027
196-214 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVVGCGNSGMEVCLDLC

Gene3D: G3DSA:3.50.50.60
206-240 G3DSA:3.50.50.60

GMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVAT

Gene3D: G3DSA:3.50.50.60
302-332 G3DSA:3.50.50.60

ARIRSGHIQVVPGIKRFFRGGAELVDGRRVA

superfamily: SSF51905
322-406 SSF51905

GAELVDGRRVAADAVILATGYHSNVPQWLKGSDFFTQEGYPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEK

Gene3D: G3DSA:3.50.50.60
333-403 G3DSA:3.50.50.60

ADAVILATGYHSNVPQWLKGSDFFTQEGYPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox