PRGDB00064033 (Zm.21310)

From PRG Wiki
Jump to: navigation, search
Zm.21310
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 67025159 (CO453908)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

MZCCL10199G12.g Maize Endosperm cDNA Library Zea mays cDNA, mRNA sequence

DNA Sequence

TTCGAAACAGCCACGCGTCCGTGTTTCATTACTTGGAGAAACGGAGAGAAGAACTTGAGGCATTGTTACTTGCTGAACGGTCGGAGTTGGTCTGAAGGCTGACCACCGTGATCTAACAATTTCTCTTCTGTTGTAGATAAATGCTTTCTTTCTTCTTTTTCTAATGATAGCATACTGTTTGGTCATGTCCCTGAGTCATTCATCCAGAAGTCACTTGATTGAAGTGTATCTTCTTTAGTTTCTATTCTCGGGCTGGACATGTGCGCGGATATCATCGTCGCCAACGAGCTAATGCGCGGCATCTCCGGCGGCCAGAAGAAGCGCCTCACCACAGGGGAGATGCTGGTCGGCCCCCGGCCAAGGTGCTATTCATGGACGAGATCTCCACAGGCCTCGATAGCTCCACCACCTTCCAGATTGTCAAGTGCATCCAGCAGATCGTCCACCTGGGCGAGGCCACCGTCCTGGCCTCGCTGCTCCAGCCCGCGCCGGAGGTCTTCGAGCTCTTCGACGATGTCATGCTGCTATCCGAGGGGCAGATCGTCTACCAGGGGCCCCGGGAGTACGTGTTGAGTTCTTCGAGAGGTGGCTTCCGGTGCCCGCAGAGGAAAGGTGAACTTGATTTCCTTCAGGAGGTTACATCAAAAAAAGATCAGGAACAGTACTGGATACAAAATGNAAAACCATATCACTATGTATCAGTACCTGAATTTGTTGCNAAGTTCAAGAAATTTCATATGGGGAAGAAGCTCAAGAAACAACTTTCGGTGCCCTTTCACAAGAGNGAAATACACAAATCTGCTTTGGTCTTCTCTGAGAAGTCTGTCTCTACTTTGGAGCTTCTCAGGTCTCATGGGCCAAGAATGGCTTC


Protein sequences

Name Description Sequence
Zm.21310 translated coding region predicted by ESTScan from UniGene Zm.21310

MCADIIVANELMRGISGGQKKXPHHRGDAGRPPAKVLFMDEISTGLDSSTTFQIVKCIQQIVHLGEATVLASLLQPAPEVFELFDDVMLLSEGQIVYQGPREYVLSSSRGGFRCPQRKGELDFLQEVTSKKDQEQYWIQNXKPYHYVSVPEFVAKFKKFHMGKKLKKQLSVPFHKXEIHKSALVFSEKSVSTLELLRSHGPRMAS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
8-109 no description

ANELMRGISGGQKKXPHHRGDAGRPPAKVLFMDEISTGLDSSTTFQIVKCIQQIVHLGEATVLASLLQPAPEVFELFDDVMLLSEGQIVYQGPREYVLSSSR

superfamily: SSF52540
33-103 P-loop containing nucleoside triphosphate hydrolases

PAKVLFMDEISTGLDSSTTFQIVKCIQQIVHLGEATVLASLLQPAPEVFELFDDVMLLSEGQIVYQGPREY

HMMPanther: PTHR19241:SF10
45-191 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTTFQIVKCIQQIVHLGEATVLASLLQPAPEVFELFDDVMLLSEGQIVYQGPREYVLSSSRGGFRCPQRKGELDFLQEVTSKKDQEQYWIQNXKPYHYVSVPEFVAKFKKFHMGKKLKKQLSVPFHKXEIHKSALVFSEKSVS

HMMPanther: PTHR19241
45-191 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTTFQIVKCIQQIVHLGEATVLASLLQPAPEVFELFDDVMLLSEGQIVYQGPREYVLSSSRGGFRCPQRKGELDFLQEVTSKKDQEQYWIQNXKPYHYVSVPEFVAKFKKFHMGKKLKKQLSVPFHKXEIHKSALVFSEKSVS

Seg: seg
155-167 seg

KFKKFHMGKKLKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox