PRGDB00064037 (Zm.21506)

From PRG Wiki
Jump to: navigation, search
Zm.21506
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195614473 (EU956949)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 1578421 CBL-interacting serine

DNA Sequence

CTCTCCCAAGTTTAGGCCatcccctcccctccccacctccccgtcgtcgtagtcccctGTTCATCCATCGCAAGAACTCCTGGGATCGCGCTGGGTTCGCCGCTTGCATGCATGCACGCACAAGCCCGCGAGCCCGGCCGGGGTGCCAGCATATTCGTTCGCTAGCTCGTGGGCTCTTCTCCGTCTCCGATCCCTTCCGTCCGCGCTGAAGAACATGCGCGCGCGCCGGGCTGTTTAGATCCGATCCGATCCAGGCCTTCTTCCGTTGCAACCTGTGCCTTGAGGCCTCCTGGTGATCGATCTTCTGCATTAATTGCTGGCTCAATGGTCGCCACAGCCACAGGCGTAGAGTGCTGCAAGATCTTTGGTTTTGTTGCTCTATAAACACTGCATGTGTTCAGTATTGTGAGGCCATTTTAAGGAATGCAGAAAGATGTGTTTGAGTGAAAAAGATTTCTGCTCTGAAGAGGAGCACATTTCTCCAATAAATTTCGAATCGCTAATAATTCTTGATGAGCGAGGATTTCAAGCACACATTAGACGCATAGTAGAAAATAGCTGTGATGCAACTGATGTCAGAAGAAATATCGCAATGCTATGTCATATAATTTCTGAAGACGGCTGAAGTTCTCTCTTTACCAAGTTCCTACAATCAGTTGGTAGCAGGTGTCTATATATATATGATGGAAGCAGAGAAGAATGGAAACATTCTTATGCAAAAGTATGAGGTTGGAAAATTATTGGGGCAAGGAACATTTGCCAAGGTATACCATGCTAGGAACATAGAGACCTCTCAAAGTGTTGCTATCAAGGTTATTGACAAGGACAAAATTTTTAAGGTTGGGCTAATGGAGCAGATCAAACGAGAGATATCGGTGATGAAACTGGTGAGGCACCCAAACATCGTGCAACTTTATGAGGTCATGGCTACTAAATCAAAGATATACTTTGTGCTTGAATATGTCAAGGGTGGTGAATTGTTTAACAAAATTGCTAAAGGAAAGTTAAGAGAAGATGCTTCCAGGAAATACTTCCAGCAATTGGTTAGTGCGGTTGATTTTTGTCATAGTAGGGGTGTGTATCATCGTGATTTGAAGCCAGAAAACCTACTCGTTGATGAGAATGGGAATCTAAAAATTTCAGATTTTGGATTGAGTGCTCTTGCTGAATCAAGACGCCAAGATGGTCTTCTACACACAACTTGTGGTACTCCAGCATATGTGGCGCCAGAGGTTATTAGCCGAAAAGGATATGATGGTGCAAAGGTTGACACATGGTCCTGTGGTGTGATCCTATTTGTTCTTATGGCTGGATATCTTCCTTTCCAAGATTCAAATTTGATGGAGATGTACAGAAAAATTGGAAAAGCAGATTTCAAATGCCCACCATGGTTTCCATCTGATGTACGCAAGTTAGTGTCAAGAATTCTTGATCCAAATCCAAGGACTAGAATGCCAATTACAAAAATAGTGGAATGCTTTTGGTTCAAAAAGGGCATTGACAACAAGCTAATCCGAAAGAATATCGAGATGAAAGGGAAAGTTTCAGCTCTCACTGATGTTAATGTAGTTTTCTCATCCACGGGTATTGGTAGCAACAATAACAAATTGGTTGATGTGGAACAAGATGTAGCAAAGATTACCAACCTGAATGCTTTTGACATTATTTCCCTTTCAGAAGGCTTTAATCTTTCAGGCTTATTTGAAGAGTCCGAGAAAAGAAAAGAGGCACGCTTCACATCTAGTCAATCAGCTTCAACTATTATATCAAAACTAGAAGATGCTGCCACCTGTTCAAAGATGACAATAAAGAAAAAAGAAGGTGGTGTGCTAAAAATGGAAGGTGCAAATGAAGGAAGGAAAGGTGTACTATCTATTGATGCTGAGATCTTTGAAGTTACTCCTGCTTTCCATCTTGTAGAGATTAAGAAAAATAATGGGGATACACTAGAATATGAAAATTTGTTTAAGCAGGACATGAAACCAGCGCTTAAAGACATTGTTTGGGCATGGCAAGGTGAGAGTAAGGACCAACAGGCCAAGGATCACAATCAATCATAAATTACTCAACCAGTTTGTTTCCATAATAAGAAATAATGTTTGTTAGTGTTCAAAAGTTGTATCTACTTCAAATTTTCTCGCATTTGACATAAACATGTGATCTGATTCAGAGTTTGTTAAGAACCATAGTATTGTTATGTTACATCTATCATTaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.21506 translated coding region predicted by ESTScan from UniGene Zm.21506

MEAEKNGNILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGIDNKLIRKNIEMKGKVSALTDVNVVFSSTGIGSNNNKLVDVEQDVAKITNLNAFDIISLSEGFNLSGLFEESEKRKEARFTSSQSASTIISKLEDAATCSKMTIKKKEGGVLKMEGANEGRKGVLSIDAEIFEVTPAFHLVEIKKNNGDTLEYENLFKQDMKPALKDIVWAWQGESKDQQAKDHNQS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
2-271 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

EAEKNGNILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWFKKG

HMMPanther: PTHR24343
2-271 FAMILY NOT NAMED,SERINE/THREONINE KINASE

EAEKNGNILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWFKKG

Gene3D: G3DSA:3.30.200.20
4-110 no description

EKNGNILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLRE

superfamily: SSF56112
IPR011009
9-364 Protein kinase-like (PK-like)
Protein kinase-like domain

ILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGIDNKLIRKNIEMKGKVSALTDVNVVFSSTGIGSNNNKLVDVEQDVAKITNLNAFDIISLSEGFNLSGLFEESEKRKEARFTSSQSASTIISKL

HMMPfam: PF00069
IPR017442
14-268 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWF

ProfileScan: PS50011
IPR000719
14-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWF

HMMSmart: SM00219
IPR020635
14-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECF

HMMSmart: SM00220
IPR002290
14-268 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIKREISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWF

PatternScan: PS00107
IPR017441
20-43 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYHARNIETSQSVAIK

Seg: seg
42-53 seg

IKVIDKDKIFKV

Gene3D: G3DSA:1.10.510.10
111-288 no description

DASRKYFQQLVSAVDFCHSRGVYHRDLKPENLLVDENGNLKISDFGLSALAESRRQDGLLHTTCGTPAYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWFPSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGIDNKLIRKNIEMKGKVS

PatternScan: PS00108
IPR008271
132-144 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLV

ProfileScan: PS50816
IPR018451
317-341 NAF
NAF/FISL domain

AKITNLNAFDIISLSEGFNLSGLFE

HMMPfam: PF03822
IPR004041
319-377 NAF
NAF domain

ITNLNAFDIISLSEGFNLSGLFEESEKRKEARFTSSQSASTIISKLEDAATCSKMTIKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox