PRGDB00064038 (Zm.21558)

From PRG Wiki
Jump to: navigation, search
Zm.21558
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 60358535 (DN225508)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

MEST1175_D10.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mRNA sequence

DNA Sequence

ttttttttttttttttttGCCGTCGTATGCAACAAGTAACCAAACATTACAAGTAATCCTCTGTTGGGCGGTTGCTGCTATAACACCACACTTACTTTCTAAACAGGACCGGGGATAGCCTCACCGCCGCACCCGACCGCACGCCTCTACTATTATTGTCTTGCTATGTCCTCAAGCCTTTTCAGTATTTTCTTCGTATCCGGTCTCAACGACGGCGACGGATTACAGCAGGCCGTCGCCAGTTCGAAGTAGGCGTCCAGGCGGCCCTCCATCCCGGAGTCCTTGCTCCGCTTCAGAAGAAGCTCGGAGCCGAAAGCTTCTGAGATCTTCCTCTCCAGGACCAGGTCTCTGAAGGAGGCGGGCAGGTGGATGTCGCGCGCGTTCGGCGGCGGCTTATTACGGCCGTCTGCGACCTCCTTCTGAGCGAGCATCTCGACCATGATCACTCCCAGGCTGTACACGTCGCTCTCCCTTGTGGCGTCCCTCATCTTCATCAGCTCCGGGGCCTTGTAGCCCTGCGCCGCAGACGTCTCGAGCATCTCCTGCGCCGCGGCGGAGTTCAGCAGGAGGTAGAGCCCGAAGTCTGAGATCCTGGGCTGGAAATCGGCGTCCAGCATGACGTTGTTTGTTTTTAGGTTGCCGTGAACGTTTGCCTTGTGCGA


Protein sequences

Name Description Sequence
Zm.21558 translated coding region predicted by ESTScan from UniGene Zm.21558

SHKANVHGNLKTNNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRLEDIARQXXXRRAVGCGGEAIPGPV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-172 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SHKANVHGNLKTNNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRLEDIARQXXX

Gene3D: G3DSA:1.10.510.10
5-164 no description

NVHGNLKTNNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRLE

superfamily: SSF56112
IPR011009
6-163 Protein kinase-like (PK-like)
Protein kinase-like domain

VHGNLKTNNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRL

HMMPfam: PF00069
IPR017442
6-162 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VHGNLKTNNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKR

HMMPanther: PTHR26393:SF175
13-176 OS04G0548400 PROTEIN (FRAGMENT)

NNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRLEDIARQXXXRRAV

HMMPanther: PTHR26393
13-176 FAMILY NOT NAMED,FAMILY NOT NAMED

NNVMLDADFQPRISDFGLYLLLNSAAAQEMLETSAAQGYKAPELMKMRDATRESDVYSLGVIMVEMLAQKEVADGRNKPPPNARDIHLPASFRDLVLERKISEAFGSELLLKRSKDSGMEGRLDAYFELATACCNPSPSLRPDTKKILKRLEDIARQXXXRRAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox