PRGDB00064043 (Zm.22137)

From PRG Wiki
Jump to: navigation, search
Zm.22137
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194697333 (BT037746)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0193C05 mRNA, complete cds

DNA Sequence

CTCCATCCGAGTCAGAGTCTTCGGCTCCAAGCCGCCCCACTGTTCCTCCTCGACTCCAAGCACCGCGCCGGCAGCGTGAGGAGAGGGCTGTCGCGGGCCGCCCGCAGGCTCCTCTGCTGCGGCAGGGCCGCCTCCCCGGAGGACCTATCTGATGAAGGAAGTGGATCATTGAGGTGGGTGTTCTCATTGAGAGAGCTTCGATCAGCAACAAACAGCTTCAATTACGATAACAAGATTGGAGAAGGGCCACTTGGGAGTGTGTATTGGGGACAAGTTTGGGATGGTTCTCAGGTTTCTGCTCCGTACATCTTCACCCTTGCTGTGAATTTAACTTTCAACTTTGTTGCCTGCCACTTCTCGCCCAGTCACAGTTACTTTACACATGCAAATATTTTATCGGTACCTATCTCACTAAATAACCGAACAATTACTTATACTTCTTTTCTTTTTGTTTTGGGACATTGATCTTCGATTGCGTTATTATTAGGTTGGTAGGATATGTTGTCATTGGAAGTCAACAAAAAAATTATATGAACTGGCTACAGGTTTGCATATCTCCATCTTGTAAATaaaaaagaaaaaTGCCTGCCTCACCCTGTCATGGTGGCAACTATTGGACGCGTCTTCTTTAAAATTATGATTGAGGTCTCATGTTCCTGCAGAGTAATATTCTTTTGAATAATTGTGAGAAGTATTGGTATGGTGCTTATAGACAAATAAAGTCCATCTCGTAAGTATGCTTTGTTCTGTGTCTACATTTATTCTTTTTTACATGTGTAGTTGTGTCCATATTTTGCAGATTGAGTAGCTGAGAATATTGTGACAACGTGTCATTCCATGCATCACCCTGTTTCCATCTTTTGTATTATATAAAACTAAGTTGAAATCAATGCAACCAACTGATTGACTTTACCAATCTTCATTGATCCAGATCGCTGTCAAGAGGTTGAAGAGTGCAAAGAATGGCACAGAAGCGGAATTTGCTTCAGAAGTCGAGATATTGGGAAGAATAAGACACAAAAACCTCCTGAGTTTTCGTGGATATTGTGCGGATGGACCCGAACGGATTCTGGTGTATGACTTTATGGCAAACTCAAGTCTCTATGCACATCTTCATGGACCACATTCTGCTGAGTGTCTCCTTGACTGGCGGAGGAGAATATCTATTGCCATCAACACTGCTCGGGCTCTCTTGTCAGTGAACGACCTCTTTATCTTTGTTCATAACCGAAAAACATTGATAATTCATACATTGTTGCTTTTGTTAAACACTGACCGCTATAACTCAAGTACTTTCTCACAGGTACCTTCACCACTATGCAACACCTAAGATAATCCATGGAAGCATCAAGACCACCAATGTGTTACTGGATTCAGACTTCCAGGCACATGTTGGCGATTTCGGTCTGATAAGGTTTATTCCTGATGGAATGGATCATGAAAAGATTACCAGCGAAAGCCAACGAGGCTATCTTGCTCCTGAGTACATTATGTTCGGCAAACCAACTGCAGGTTGTGATGTATACAGCTTTGGAATAATACTATTGGAGCTTGCTAGTGGCAAAAGGCCGATAGAAAAGTCGTGTTCTGTTAAGACATATGGAATTCGAAACTGGGTGCTCCCGCTGGCAAGGCAGGGTAGATATGATGAAATTGCAGACTCAAAACTGAGCGACAAGTTCTCTGAATCTGAACTGAGAAGAATGGTCTTAGTTGGGCTAGCATGTACTCATTCAGAATCTGAAAAAAGACCAACAATGCTTGAAGTTGTGCCGTTGCTGAAAGGCGAATCAAAAGAAACCCTTATTAAGCTTGAAAGAGATGAGTTGTTCAGCTCAGACTCGATGGTGAGTTCACAAGGAACACCAACCCCAGATGGGGGCACAGACTCTGTGCCAAAGGAAGATCAAGAACTGGTTGGAGCGTGAAATGTGATATGTTGCTACTGTAGGCGATGGTAGAATGCGGATTTGTGTTATTGGTTGATGATTGGTTTGTGCGGTTTGACATGAATGTAAATTGTATAGGCATTGTTTTCTGTAAGGAGGTATTTACCCATCCCTTTTGAGAGATTAAGGAAGAGCATGGGGGCTGGAGATAGCTGTTTATGCGAAGTGGTTTTTGTATGCACCGCATAGAAAATGCACATGTTTTTTC


Protein sequences

Name Description Sequence
Zm.22137 translated coding region predicted by ESTScan from UniGene Zm.22137

MQPTDXLYQSSLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSMVSSQGTPTPDGGTDSVPKEDQELVGA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-297 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MQPTDXLYQSSLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLL

HMMSmart: SM00220
IPR002290
1-297 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MQPTDXLYQSSLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLL

HMMSmart: SM00219
IPR020635
6-297 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XLYQSSLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLL

HMMPfam: PF07714
IPR001245
10-295 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SSLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVP

superfamily: SSF56112
IPR011009
11-319 Protein kinase-like (PK-like)
Protein kinase-like domain

SLIQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSM

Gene3D: G3DSA:3.30.200.20
13-66 no description

IQIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFM

HMMPanther: PTHR24420:SF427
14-341 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSMVSSQGTPTPDGGTDSVPKEDQE

HMMPanther: PTHR24420
14-341 FAMILY NOT NAMED,FAMILY NOT NAMED

QIAVKRLKSAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERILVYDFMANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLSVNDLFIFVHNRKTLIIHTLLLLLNTDRYNSSLSHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSMVSSQGTPTPDGGTDSVPKEDQE

Seg: seg
116-126 seg

TLIIHTLLLLL

Gene3D: G3DSA:1.10.510.10
136-328 no description

SHRYLHHYATPKIIHGSIKTTNVLLDSDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLELASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTHSESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSMVSSQGTPTP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox