PRGDB00064048 (Zm.22750)

From PRG Wiki
Jump to: navigation, search
Zm.22750
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224030554 (BT067456)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0051O03 mRNA, complete cds

DNA Sequence

CCGACACTGCGTAGTCCACCACTCTTTGCGCTGCTCTTCCAAAAATCTTCGCCGCTGCCATCATTTCTGCGTATCGTAGTCGTAGAGGACACGAGGGAGACTTTTTTACCTCACAAAGACAGCCGCCTGTGCCTCGTTGCTGCTACGGTGCTACCCACCCTGCCACCCATATGCTCCTCCCACCATGATGGCCTCGACCTCGTTCGTCTGGTCGGTGTGGACCGTCGTGTCGCTGACGCTAACGCTTGCCTCGGCATCAGCAGACGACCAAGAGGGAGGAGCACACTGCCCGCCCGTGCTATGCGGCGGCGTGAAGATCGCCTTCCCGTTCGGGGTCGTCCCGGAGCAGGCGACGGCCACCAACTGCGGCGCAATCGGGTTCCAGGTCCGCTGCGTCAATGGCACGCCGTACCTCGGATACAGCCGGTACGACCACTGGCTCCAGGTCCTCAGCGTCTTCTACAACAACGCCTCCTTGATCGTCGCCGACTCTCACGAACTCGAGACGCTCGGAGCCTCGGACGGCGGCGGCTCCGTTGTCTGCCGCATCCCCGAGAACAACAGCTCCACCAAGGTCGGCCTCCCGTTCTCCATCAGCCCTCTCAACCAGGACCTCATCCTGTACAACTGCACCAAGGCGCCGGCGCCGGACGAGGAGGGGCTTGTGGAGATGACGAGATGCGGCAACCGCACTTTCGCCCGCATCGGAGGGCGTTACGGCGAGCCGGACGGCGGCGGATACTCCTTGGACGGCTGCGGTGCCACTGTCGTGCCCGTGCTTGTAAAGGACGATGGCAAGGCGAACGCGAGCGACTACGAGCAACTCATAAGTGGCGGCTTCCTCTTGACATGGCAGTGGCAGACAAGTACCAAAGGGAATGGCAGGAAGATTCCACTAATAGTTTCGATTTCAGTGGCTGCAAGCTTGCTCCTACCATGTATATATGTGTTGGTATGGCATAGGCAAAAACTGGAGTTTTTTCTATGCAAGAAGACCAGCAGTGCCATAGAAGAGAACATTGAGGCCCTAATATTAGCACATGGATCACTAGCTCCAAAAAGGTACAGGTACTCAGAAGTAACAAAGATAACATCTTCTCTTAATATTAAGCTTGGGGAAGGTGGTTATGGCATGGTTTTCAAGGGAAGGCTAGATGATGGTCGTCTAGTTGCAGTGAAATTCCTGCATGACTCCAAAGGTGACGGTGAGGAGTTTGTGAACGAGGTTATGAGTATTGGCAGGACATCACACATTAATATCGTTAGCTTATTTGGGTTTTGTTTGGAAGGCTCAAAGCGGGCCCTAATATATGAGTATATGTCAAATGGTTCTTTGGATAAGTATATATACACAGAGAATCCGAAGGCAGTTTTAGGATGGGATAAGCTCTATACCATAGCAATTGGGATTGCTAGAGGGTTGGAATACTTGCACCACAGTTGTAATACACGCATAGTCCATTTCGACATCAAGCCTCAAAATATCCTTCTGGATCAGAACTTTCACCCAAAGATTGCTGATTTTGGTTTGGCCAAGTTGTGTCATATGAAAGAGAGCAAGCTTTCTATGACTGGTGCCAGAGGTACGCCTGGGTTCATAGCTCCTGAAGTGCACTCTCGGACATTCGGGGTTGTTTCAACAAAAGCAGACGTTTATAGTTATGGAATGATGCTGCTAGAGATGGTTGGAGGCAGAAAAAATGTTAACTCAGCGGCTCAAGAGTCAAGTGAAAAGTATTTTCCACATTGGATTTACGACCACTTTGGCCAAGAGGATGGACTGCAGGCGTGTGAGGTCACACGTGAAAATGAAGGGATCGCAAAAAAACTGAGTGTGATTGGCCTATCGTGCATCCAAATATTACCAATGCATCGCCCTACCATCGGAAAGGTCATGGAAATGTTCGAGAGAGGATCGGATGAACTGGACATGCCACCAAGGCAAAACTTCAGCCAAATATTCGAAGATCCAGTACACAGTTTGAATGCGGAAACCATGAGCATGATTAGTGGCACCAAAGCAAAAGCTTATAGTGAAGTGCTAAAGATGAAGGAGATAAGCGTCGTGAACTCAAAAACCATACAACGGTTGCCAACTCTGTAAAACAGTTAGTTATCTACTACATTGGAAATGAACATTAAATCGGGAGCCACCACCAAAATACGGTGTCTCCAAACAGGAGTTGGACTTAAATAATATAAAATATATAATGGTTGTGTCATGATATTCGGTGAACTATGGTATTATAAATTGTAGTTTaaaaaaaaCAATGTTCCGAAGCAGTCCCTTGTATGCATTCGTCTTGTTTC


Protein sequences

Name Description Sequence
Zm.22750 translated coding region predicted by ESTScan from UniGene Zm.22750

PTLRSPPLFALLFQKSSPLPSFLRIVVVEDTRETFLPHKDSRLCLVAATVLPTLPPICSSHHDGLDLVRLVGVDRRVADAKLASASADDQEGGAHCPPVLCGGVKIAFPFGVVPEQATATNCGAIGFQVRCVNGTPYLGYSRYDHWLQVLSVFYNNASLIVADSHELETLGASDGGGSVVCRIPENNSSTKVGLPFSISPLNQDLILYNCTKAPAPDEEGLVEMTRCGNRTFARIGGRYGEPDGGGYSLDGCGATVVPVLVKDDGKANASDYEQLISGGFLLTWQWQTSTKGNGRKIPLIVSISVAASLLLPCIYVLVWHRQKLEFFLCKKTSSAIEENIEALILAHGSLAPKRYRYSEVTKITSSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDELDMPPRQNFSQIFEDPVHSLNAETMSMISGTKAKAYSEVLKMKEISVVNSKTIQRLPTL

Domains

Domain Start-End Description Sequence

Seg: seg
63-89 seg

DGLDLVRLVGVDRRVADAKLASASADD

HMMPfam: PF13947
IPR025287
94-211 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

AHCPPVLCGGVKIAFPFGVVPEQATATNCGAIGFQVRCVNGTPYLGYSRYDHWLQVLSVFYNNASLIVADSHELETLGASDGGGSVVCRIPENNSSTKVGLPFSISPLNQDLILYNCT

Seg: seg
236-246 seg

GGRYGEPDGGG

HMMPanther: PTHR24420
297-699 FAMILY NOT NAMED,FAMILY NOT NAMED

IPLIVSISVAASLLLPCIYVLVWHRQKLEFFLCKKTSSAIEENIEALILAHGSLAPKRYRYSEVTKITSSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDELDMPPRQNFSQIFEDPVHSLNAETMSMISGTKAKAYSEVLKMKEISVVNSKTIQRLPT

HMMPanther: PTHR24420:SF441
297-699 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IPLIVSISVAASLLLPCIYVLVWHRQKLEFFLCKKTSSAIEENIEALILAHGSLAPKRYRYSEVTKITSSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDELDMPPRQNFSQIFEDPVHSLNAETMSMISGTKAKAYSEVLKMKEISVVNSKTIQRLPT

superfamily: SSF56112
IPR011009
337-643 Protein kinase-like (PK-like)
Protein kinase-like domain

EENIEALILAHGSLAPKRYRYSEVTKITSSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDELD

Gene3D: G3DSA:3.30.200.20
352-440 no description

PKRYRYSEVTKITSSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYM

ProfileScan: PS50011
IPR000719
365-642 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDEL

HMMSmart: SM00219
IPR020635
365-635 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMF

HMMSmart: SM00220
IPR002290
365-635 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SSLNIKLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMF

HMMPfam: PF00069
IPR017442
370-582 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KLGEGGYGMVFKGRLDDGRLVAVKFLHDSKGDGEEFVNEVMSIGRTSHINIVSLFGFCLEGSKRALIYEYMSNGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPH

PatternScan: PS00107
IPR017441
371-393 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGYGMVFKGRLDDGRLVAVK

Gene3D: G3DSA:1.10.510.10
442-665 no description

NGSLDKYIYTENPKAVLGWDKLYTIAIGIARGLEYLHHSCNTRIVHFDIKPQNILLDQNFHPKIADFGLAKLCHMKESKLSMTGARGTPGFIAPEVHSRTFGVVSTKADVYSYGMMLLEMVGGRKNVNSAAQESSEKYFPHWIYDHFGQEDGLQACEVTRENEGIAKKLSVIGLSCIQILPMHRPTIGKVMEMFERGSDELDMPPRQNFSQIFEDPVHSLNAET

PatternScan: PS00108
IPR008271
485-497 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDIKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox