PRGDB00064054 (Zm.23219)

From PRG Wiki
Jump to: navigation, search
Zm.23219
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 33100220 (CF060180)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

QCS4b12.yg QCS Zea mays cDNA clone QCS4b12, mRNA sequence

DNA Sequence

ACACACTGCAACACTCGGATGCTTCCAACAGGTTTGAGAACGAAAATTTGGAATTTCCATCAATTGCCTTAGAAGACATCATCGTTGCGACAAACGACTTCTCTGATTTTAACATGCTTGGAAAAGGTGGATTCGGAAAAGTTTACAAGGCAATGTTGGAAGGTGGCAAGGAAGTAGCTGTTAAAAGGCTCAGTAAAGGCTCTACACAGGGGGTCGAGGAATTTAGAAATGAAGTAGTTCTGATTGCTAAACTGCAGCACAGAAACTTAGTTAGACTTCTTGGTTGCTGCATTCATAAAGATGAGAAGTTACTGATATATGAATACTTACCAAACAAAAGCTTGGACGCCTTCCTTTTTGATGCTACAAGGAAATCTGTGCTTGATTGGCCATCCCGTTTCAAAATAATTAAAGGTGTAGCACGAGGACTTCTTTATCTCCACCAGGATTCAAGATTAACGATAATTCATAGAGATCTCAAAGCAAGCAACATCTTGTTAGACACAGAAATGAGTCCCAAGATATCGGATTTCGGTATGGCGAGGATTTTTGGTGGAAATGAGCAACATGCAAACACTACTCGAGTTGTTGGAACATATGGTTACATGTCTCCTGAATATGCTATGGAAGGCTCATTCTCTGTCAAGTCTGACACCTAT


Protein sequences

Name Description Sequence
Zm.23219 translated coding region predicted by ESTScan from UniGene Zm.23219

XTLQHSDASNRFENENLEFPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
6-220 Protein kinase-like (PK-like)
Protein kinase-like domain

SDASNRFENENLEFPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

HMMPanther: PTHR24420:SF432
13-220 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ENENLEFPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

HMMPanther: PTHR24420
13-220 FAMILY NOT NAMED,FAMILY NOT NAMED

ENENLEFPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

Gene3D: G3DSA:3.30.200.20
19-95 no description

FPSIALEDIIVATNDFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLG

ProfileScan: PS50011
IPR000719
34-220 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

HMMSmart: SM00219
IPR020635
34-220 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

HMMSmart: SM00220
IPR002290
34-220 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

HMMPfam: PF00069
IPR017442
38-220 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVRLLGCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

PatternScan: PS00107
IPR017441
40-62 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGKVYKAMLEGGKEVAVK

Gene3D: G3DSA:1.10.510.10
96-220 no description

CCIHKDEKLLIYEYLPNKSLDAFLFDATRKSVLDWPSRFKIIKGVARGLLYLHQDSRLTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGSFSVKSDTY

PatternScan: PS00108
IPR008271
155-167 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox