PRGDB00064093 (Zm.26252)

From PRG Wiki
Jump to: navigation, search
Zm.26252
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76922595 (DV169077)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFb0167P24.f ZM_BFb Zea mays cDNA 3', mRNA sequence

DNA Sequence

CGACCAAAACAATGACTTATTCAGTAACAAATCTAAATACAATTTACAAATGAAGCTGCGCCACAGTAAAGAACCaaaaaaatttaaaaaaaaagagaatgtgaccttcatctgttgaaaaaatcaaaaaaTCCTTTCCATGTTAACATCCTAATTCTGCTGCTATGTTCCGATCCGACAGCAGAAGGTCAAGAGCTAACCCTAACGGACTCCAAGAACTGTACCACTTCTGCCATGCTAGGTCGGCTTGACGGTGTGTTGGAAGTGCACACCAGGCCCAGTTTGAGCACTTGAACCAGCTCAGCTTCGACAAACCCCCTCAGGCTTCGATCGAAGCAGTCCGACGCAGTTCCGTCCTCCAATATCCCTCTCACGTAGTCACGGAGAACCACAGCTGTAGCTCCTATCCCAGGGCTGTCTACAGGTTTCCTCCCCGTCACGATCTCAAGCAAAACCACCCCAAAGCTAAACACGTCACTCTTGTCGCTATATCTCAGTGTCGGAGATGCCAGCTCCGGCGCAATGTACCCGATCGCGGTGTGAATTCTGCTCAGCTCAATGCTTCCTAGTATCGGCAGCAGCTTCCCCAACCCGTAGTCAGACAGTCTAGCTTCGTATCTCCCATCTAACATGATGTTGGAGGACTTGATGTTGAGGTGCAGGATCTG


Protein sequences

Name Description Sequence
Zm.26252 translated coding region predicted by ESTScan from UniGene Zm.26252

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQFLESVRVSS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-151 no description

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQF

HMMPfam: PF00069
IPR017442
1-150 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQ

ProfileScan: PS50011
IPR000719
1-152 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQFL

superfamily: SSF56112
IPR011009
1-152 Protein kinase-like (PK-like)
Protein kinase-like domain

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQFL

HMMPanther: PTHR24420
1-156 FAMILY NOT NAMED,FAMILY NOT NAMED

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQFLESVR

HMMPanther: PTHR24420:SF874
1-156 SUBFAMILY NOT NAMED

QILHLNIKSSNIMLDGRYEARLSDYGLGKLLPILGSIELSRIHTAIGYIAPELASPTLRYSDKSDVFSFGVVLLEIVTGRKPVDSPGIGATAVVLRDYVRGILEDGTASDCFDRSLRGFVEAELVQVLKLGLVCTSNTPSSRPSMAEVVQFLESVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox