PRGDB00064096 (Zm.26365)

From PRG Wiki
Jump to: navigation, search
Zm.26365
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238006625 (BT083995)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0063E12 mRNA, complete cds

DNA Sequence

TGGAGCTCCGAGGCTCCACCCCCCACCAATGATGCGTCCAGACGCCTAGATGAGCACCATCCCCTTCCCCTCCACCCATCCTCAGAAGATGTCATGCTGACGGCTTCGACGTGGTCTCCAGTAGATCCGAGCGGAGCGCCTTCCCGTCTACCCCTCAAACATTGTCGCAGTGCCTGGGCCGTCGCGAGGAGCCCCCAAACACAATCTCCTCCTTAGACGTCGCCGGTCTCCTCGCTCCCTCCTCAAACGTCGTCGTGCTACCGACACTGTCTGTGGCGGCTCCAACCGGAGCACCATCCCACCTCCTCCGTCAAACGACGCTGCGGTGTTTGGGCCACCGTCGGGAGTCTGAATCTGCCCCCTCAGACATCGCCACCTCGAAACGCACAGGTTGGCGCGGTAGGGGGCACTGGTGGTTCGGCGCGGTCACCTGGCGAACGACGACGAAGAGGAGGAGGTGGCCGAGTCTATCATGAAGAGACGCTGTGAAGAGCAGTCGCCATGGCCGATGGATCAGTTGCCGGTTGCATTCATCGAAGATTTGGCCCTCTCCACCACCATGTCGCTACCCCATACCCGTCTTCCCTGCATATCTGAATGATGCACCTTCAATCCACCGCTGCCCAAAGAGCGAATGGGGAAGGACCGACCTGAGCATTCTGTCCGGTAGCTGGGTAGCAAGAAGCACCAGCCCTTCCCCCTCCCAAGATATAGATCTTATACGGGTAATGGGTTGTACGGCCCAGCCGATGATCCGCCTCACCCAGCCCAATCAGGCAACCACTCATTCGTTTCCATCGCGCCGACCCCGTGCCCCGCTGGCCGCTGATCCGCCTCGCTTCCCTCCGCCATCTCGGCGACCCCGCGGCGCGGTCCACGCACAGCCCGTCCCAAAACCCAGACCAACTGCCACTAGCGGTAGAGCCTAGCGCGCAGCGCACACGCAGTATACAACTCTTCAATCCTTCGctgcctgcctgcctgcctgccAGTTTCCCTGCCCTCCCCATCCACTCCAATCCCACCACCACCACCCCGGGCCGCAGCCCGCAGCAAGCACGCAGTCTCCCACCTGGTCAAACCGCTCCCCTCCCCCACCACCACCGCCGCGCCCCAAtccgcgtgcatccgtccgccatgcctcctcctcgcctcctgcccccgatcatcgtcctcctcctCCTGGCCCCTCCCGCGGCGCCGCAGCCCGCGCCCGGATCGGAGGCGGCGCCGCAGCAGGACGGCCTGCGCTGCCTCCGGGGCGTCAAGCACGACCTCGCCGACCCCAACGGGCGCCTCGCCGACTGGGACTTCAAGAACACTTCGGGGGGCGCCGTCTGCAGTTACAGCGGCATCGGCTGCTGGAACCTGCAGGAGTCCCGCGTGCTGTCGCTCTCGCTCTCCGGCTTCGGCCTCGTCGGCTCCATCCCCTCCTCGCTCCAGTACTGCAGCGCCGCCACCACGCTGGACCTCTCTAGCAACGCGCTCGTCGGCACGATCCTGCCGGCCCTCTGCGACTGGCTCCCCTTCctcgtcaccctcgacctctcctccaaccagctcaccggcgcgatccccgcggagctcgccaACTGCCGCTTCCTCAACTCGCTCACGCTCTCCGGGAACCAGCTCTCCGGCCAGATCCCCGCCTCCCTCGCGCGGCTCGACCGGCTCAAGTCGCTCGACCTCTCGGGGAACCAGCTCTCCGGCCAGATCCCGCCCCAGCTCGGCGACCGCTTCCCCAGGGACTCCTTCTCCGGGAACTCGGGCCTCT


Protein sequences

Name Description Sequence
Zm.26365 translated coding region predicted by ESTScan from UniGene Zm.26365

WSSEAPPPTNDASRRLDEHHPLPLHPSSEDVMLTASTWSPVDPSGAAFPSTPQTLSQCLGRREEPPNTISSLDVAGLLAPSSNVVVLPTLSVAAPTGAPSHLLRQTTLRCLGHRRESESAPSDIATSKRTGWRGRGHWWFGAVTWRTTTKRRRWPSLSXRDAVKSSRHGRWISCRLHSSKIWPSPPPCRYPIPVFPAYLNDAPSIHRCPKSEWGRTDLSILSGSWVARSTSPSPSQDIDLIRVMGCTAQPMIRLTQPNQATTHSFPSRRPRAPLAADPPRFPPPSRRPRGAVHAQPVPKPRPTATSGRAXRAAHTQYTTLQSFAACLPACQFPCPPHPLQSHHHHPGPQPAASTQSPTWSNRSPPPPPPPRPNPRASVRHASSSPPAPDHRPPPPGPSRGAAARARIGGGAAAGRPALPPGRQDDLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQLSGQIPPQLGDRFPRDSFSGNSGLX

Domains

Domain Start-End Description Sequence

Seg: seg
144-154 seg

TWRTTTKRRRW

Seg: seg
264-289 seg

SFPSRRPRAPLAADPPRFPPPSRRPR

Seg: seg
333-350 seg

PCPPHPLQSHHHHPGPQP

Seg: seg
360-375 seg

SNRSPPPPPPPRPNPR

Seg: seg
379-422 seg

RHASSSPPAPDHRPPPPGPSRGAAARARIGGGAAAGRPALPPGR

superfamily: SSF52058
425-578 L domain-like,LRR

DLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQLSGQIPPQLG

Gene3D: G3DSA:3.80.10.10
425-578 no description

DLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQLSGQIPPQLG

HMMPanther: PTHR24420
425-592 FAMILY NOT NAMED,FAMILY NOT NAMED

DLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQLSGQIPPQLGDRFPRDSFSGNSGL

HMMPanther: PTHR24420:SF477
425-592 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DLADPNGRLADWDFKNTSGGAVCSYSGIGCWNLQESRVLSLSLSGFGLVGSIPSSLQYCSAATTLDLSSNALVGTILPALCDWLPFLVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQLSGQIPPQLGDRFPRDSFSGNSGL

Seg: seg
462-475 seg

VLSLSLSGFGLVGS

HMMSmart: SM00369
IPR003591
508-532 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPFLVTLDLSSNQLTGAIPAELANC

FPrintScan: PR00019
511-524 LEURICHRPT,Leucine-rich repeat signature

LVTLDLSSNQLTGA

HMMPfam: PF13855
511-569 LRR_8,Leucine rich repeat

LVTLDLSSNQLTGAIPAELANCRFLNSLTLSGNQLSGQIPASLARLDRLKSLDLSGNQL

FPrintScan: PR00019
556-569 LEURICHRPT,Leucine-rich repeat signature

LDRLKSLDLSGNQL

HMMSmart: SM00369
IPR003591
556-580 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LDRLKSLDLSGNQLSGQIPPQLGDR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox