PRGDB00064113 (Zm.27848)

From PRG Wiki
Jump to: navigation, search
Zm.27848
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76910902 (DV164087)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFb0160G06.r ZM_BFb Zea mays cDNA 5', mRNA sequence

DNA Sequence

GCAAGTCACGGTCGAACACCTCAGGGAAGACAGCGACCACAGGGAGCCGTACATCAACGTTGCCATCCAATCTGTGCCGCCATTTCTCGTTTGGCGAGATCCAGGCGGCCACCAAGAACTTCGACCAAGCCTCTCTCCTCGGTAAAGGCGGCTTTGGAAACGTGTACCTTGGAGAGATAGACAGTGGCACGATGGTGGCGATCAAGCGCGGGAACCCGACGTCTGAGCAGGGCGTCCACGAGTTCCAGACGGAGATCGAGATGCTGTCGAAGCTCCGGCACCGGCACCTCGTGTCGCTGATCGGGTACTGCGACGACATGAATGAGCTGATTCTAGTGTACGACTACATGGCGAACGGGACTCTGAGGGAGCACCTGTACAACACCAAGAGGGCGGCGCTGTCCTGGAAGAAGCGGCTGGAGATATGCATCGGCGCGGCGCGGGGGCTGCACTACCTGCACACAGGCGCGAAGCACACCATCATACACAGGGACGTGAAGACCACCAACATCCTGCTGGACGACAAGCTGGTGGCCAAGGTTTCCGACTTCGGGCTGTCCAAGACGGGTCCCAACAACGTCGACAACACCCACGTGAGCACGGTCGTGAAGGGCAGCTTCGGGTACCTCGACCCGGAGTACTTCCGGCGGCAGCAGCTGACGGAGAAGTCGGACGTCTACTCGTTCGGGGTCGTGCTGTTGGAGGTCCTGTGCGCGCGGCCCGCCCTGAGCCCCTCGCTCCCCAGGAGCAGGTGAGCCTGGGCGACTGGGCGCTGCACTGCCAGAGGAAGGGCGTGCTCGGGCAGATCATCGACCCGCACCTGC


Protein sequences

Name Description Sequence
Zm.27848 translated coding region predicted by ESTScan from UniGene Zm.27848

XKSRSNTSGKTATTGSRTSTLPSNLCRHFSFGEIQAATKNFDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANGDSEGAPVQHQEGGAVLEEAAGDMHRRGAGAALPAHRREAHHHTQGREDHQHPAGRQAGGQGFRLRAVQDGSQQRRQHPREHGREGQLRVPRPGVLPAAAADGEVGRLLVRGRAVGGPVRAARPEPLAPQEQVSLGDWALHCQRKGVLGQIIDPHLX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-121 Protein kinase-like (PK-like)
Protein kinase-like domain

TTGSRTSTLPSNLCRHFSFGEIQAATKNFDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANGD

HMMPanther: PTHR24420:SF418
14-120 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TGSRTSTLPSNLCRHFSFGEIQAATKNFDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANG

HMMPanther: PTHR24420
14-120 FAMILY NOT NAMED,FAMILY NOT NAMED

TGSRTSTLPSNLCRHFSFGEIQAATKNFDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANG

Gene3D: G3DSA:3.30.200.20
23-117 no description

SNLCRHFSFGEIQAATKNFDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYM

ProfileScan: PS50011
IPR000719
41-276 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANGDSEGAPVQHQEGGAVLEEAAGDMHRRGAGAALPAHRREAHHHTQGREDHQHPAGRQAGGQGFRLRAVQDGSQQRRQHPREHGREGQLRVPRPGVLPAAAADGEVGRLLVRGRAVGGPVRAARPEPLAPQEQVSLGDWALHCQRKGVLGQIIDPHLX

HMMSmart: SM00219
IPR020635
41-252 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDQASLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANGDSEGAPVQHQEGGAVLEEAAGDMHRRGAGAALPAHRREAHHHTQGREDHQHPAGRQAGGQGFRLRAVQDGSQQRRQHPREHGREGQLRVPRPGVLPAAAADGEVGRLLVRGRAVGGPVRAARPEPLAPQEQV

HMMPfam: PF07714
IPR001245
45-121 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLLGKGGFGNVYLGEIDSGTMVAIKRGNPTSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCDDMNELILVYDYMANGD

PatternScan: PS00107
IPR017441
47-69 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGNVYLGEIDSGTMVAIK

Seg: seg
224-243 seg

VGRLLVRGRAVGGPVRAARP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox