PRGDB00064160 (Zm.32153)

From PRG Wiki
Jump to: navigation, search
Zm.32153
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238006049 (BT083707)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0030E24 mRNA, complete cds

DNA Sequence

GTATCTCAACTCCGCCAAGCCAAGCTCAGCGAAAACTCAGGCGATCGGACGACGCCCCAAGGAACAAGTGCAGCGGAACGAAGCTTCGGCGTCCTCGTCGTCCCGTCGCAAGTGCAGATCACAAGTCCATAACAAGAAAGACAACAAAACTATGCTGAAAGATGTGCTTGCATAGAAGAGACTTCTGCAGCAACACCACCAAGGGCCTGGTGGTTCTTGCGCAAGGTCCGCAGGCCTGCTCGTCTCTTGACTTGAGCGGCGGTCACCTTGCCTGCATCTACTCCACGCCCTTCAGACTCCGACGCCACCGACCCATAAGGCGCAGTCCACCTGATTGACAACAGAAAGCTAGCCCTGTGCGTGATCACATAGTTTTTATGGAGATAAAAGATATGAAGACCAGAGGGAAGACTTTGACGGAGCGGTACGAGATGGGGAAGCTGCTGGGGAAAGGCGCGTTCGGGAAGGTGCACTATGCAAGGGACCTCGAGTCCAACCAGGGTGTTGCTATCAAGATCATGGACAAGGACAGGGTGCTCAAGGCCGGGCTCTCGGAGCAGGTAAAGCGTGAGATCACGACTATGCGGCTGGTGGAACACAAAAACATCGTTCGTCTCCATGAGGTCATGGCGACACGGAACAAGATCTACATCATCATGGAGTATGCCAAAGGGGGTGAGCTCTTAGACAAGGTTAAGAGGAGCGGCAGGCTGACGGAGGCTGACACACACAGATACTTCCAACAGCTCATTGGCGCACTGGATCACTGCCACAGCCGAGGCGTGTACCACCGGGACTTGAAGCGTGAGAATCTGTTGTTGGATGAGAATGGGGACCTTAAGGTGTCTGACTTTGGACTGAGCGCGTTTTCAGAGTCGAGGAGGACAGATGGGCTGCTCCATACTGTCTGTGGGACACCAGTGTATATAGCTCCGGAGGTGATCAAGAAGACGGGATACGATGGTGCAAAATCAGACATCTGGTCTTGTGGTGTCGTCCTGTTTGTTCTCGCTGCTGGCTACCTCCCTTTCCAGGGCCCAAACATGATGGAGATTTATCGAAAGATACATGATAGTGATTTCAGGTGCCCCAGTTGGTTTTCACACAAACTCAAGAGGCTGCTATACAAGATTCTGAACCCCAACCCTAGCATGAGACCTTCAATTCAGGAGATAAAAGAGTCTACCTGGTTTCGAAAAGGTCCTAGGGAGATCAGTGCAGTGAAGGAGAAAGTTCTTAGCGAGAATGCCACCGCCACAAATGCTGCCCCAGTGCTTGCTGCTAGGCGCAAGGAGATTGCTCACGAAGATAAGACCCTGGTTGCCACAAAACTCAATGCCTTTGAAATCATCGCGTTCTCAGCAGGGTTGGACCTTTCTGGTCTGTTTATCAAGGAGTGCAGGAAGGAGACACGGTTCACTTCAGATAAGCCTGCATTGGCCATCATCTCAAAGCTTGAAGATGTCGCGAAAGCACTGAATCTCAGGATAAGGAAGAAGGACAACAACACTGTCATCATTCAAGGGAGGAAGCATGGGGGCAATGGTGTCCTTCAGTTTGACACGCAGATCTTTGAGATCACACCATCCTGCCATCTCGTTCAGATGAAACAAACTAGTGGCGATCTACTTGAGTACCAGAAACTGTTGGAAGAGGGCATCCGACCAGGGCTGAAGGACGTTGTCTGGGCTTGGCATGGAGATGATCTGCAGCAGAAGTAGGAGTAGCTTCAGCTGTCTCCCGTAGATTATGTTCTACATTCCATTCCTTATTTTTTAGCAACAACATTCCCTTTTTTGTATTGGTGGTGATATGAACCATTAGGCTATGTTTTGTTTGAGCAATAATTGTTGTGGAGTTGAGTTGTTGTGTTACATTCTGAAGATTGTTACAGTTTTGTAATGGCTGTCAATATCAGTAATGAAAATAAATGTTGTTGATCCTT


Protein sequences

Name Description Sequence
Zm.32153 translated coding region predicted by ESTScan from UniGene Zm.32153

XYLNSAKPSSAKTQAIGRRPKEQVQRNEASASSSSRRKCRSQVHNKKDNKTMLKDVLARRDFCSNTTKGLVVLAQGPQACSSLDLSGGHLACIYSTPFRLRRHRPIRRSPPDXQQKASPVRDHIVFMEIKDMKTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRKGPREISAVKEKVLSENATATNAAPVLAARRKEIAHEDKTLVATKLNAFEIIAFSAGLDLSGLFIKECRKETRFTSDKPALAIISKLEDVAKALNLRIRKKDNNTVIIQGRKHGGNGVLQFDTQIFEITPSCHLVQMKQTSGDLLEYQKLLEEGIRPGLKDVVWAWHGDDLQQK

Domains

Domain Start-End Description Sequence

Seg: seg
29-37 seg

ASASSSSRR

HMMPanther: PTHR24343:SF45
56-405 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

VLARRDFCSNTTKGLVVLAQGPQACSSLDLSGGHLACIYSTPFRLRRHRPIRRSPPDXQQKASPVRDHIVFMEIKDMKTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRKGPREI

HMMPanther: PTHR24343
56-405 FAMILY NOT NAMED,SERINE/THREONINE KINASE

VLARRDFCSNTTKGLVVLAQGPQACSSLDLSGGHLACIYSTPFRLRRHRPIRRSPPDXQQKASPVRDHIVFMEIKDMKTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRKGPREI

Seg: seg
97-111 seg

PFRLRRHRPIRRSPP

superfamily: SSF56112
IPR011009
129-400 Protein kinase-like (PK-like)
Protein kinase-like domain

IKDMKTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRK

Gene3D: G3DSA:3.30.200.20
133-239 no description

KTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLT

HMMPfam: PF00069
IPR017442
143-398 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWF

ProfileScan: PS50011
IPR000719
143-398 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWF

HMMSmart: SM00220
IPR002290
143-398 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWF

HMMSmart: SM00219
IPR020635
143-396 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEMGKLLGKGAFGKVHYARDLESNQGVAIKIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLDKVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKEST

PatternScan: PS00107
IPR017441
149-181 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGAFGKVHYARDLESNQGVAIKIMDKDRVLK

Gene3D: G3DSA:1.10.510.10
240-412 no description

EADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSAFSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPNMMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRKGPREISAVKEKV

PatternScan: PS00108
IPR008271
262-274 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKRENLLL

Seg: seg
416-423 seg

NATATNAA

ProfileScan: PS50816
IPR018451
440-464 NAF
NAF/FISL domain

LVATKLNAFEIIAFSAGLDLSGLFI

HMMPfam: PF03822
IPR004041
443-499 NAF
NAF domain

TKLNAFEIIAFSAGLDLSGLFIKECRKETRFTSDKPALAIISKLEDVAKALNLRIRK

Gene3D: G3DSA:3.30.310.80
471-551 no description

TRFTSDKPALAIISKLEDVAKALNLRIRKKDNNTVIIQGRKHGGNGVLQFDTQIFEITPSCHLVQMKQTSGDLLEYQKLLE

Coil: coil
483-504 coiled-coil

ISKLEDVAKALNLRIRKKDNNT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox