PRGDB00064174 (Zm.33382)

From PRG Wiki
Jump to: navigation, search
Zm.33382
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195626607 (EU963016)
Gene Class Unknown
Domain Type NBS
Gene Species Zea mays

Comment?

Zea mays clone 247282 disulfide oxidoreductase

DNA Sequence

ATCACCATCTTCAAGCATATCCCATCAATATCCAGAGAGTTTGAGAGAGCGAGCATTGCGAGAGCACCATCCGACATGGACCGCTTCATCACCCAGACCGAGGGGAGGAGGGACCGCAAGCATATCCCATCTGTATCTAGAGAGTTTGCGGGAGCGAGCGCTGCGAGAGCATCGCCTGGCATGGAACGCTCCATCGCCAAGTCTGAGGTGAGGTGGGACCGCTTTGTCGAGACTGGTAAGGGGCGATGGTGCAGGATCCACTGACCACGGAGACTGGGGGCAAGATGGAGCACGACCTGCTCATGTACAGCCCGCGCAGCGCCGCGAGGGCCACCGCAACCGGCATCCCCATCGGCGACCAAGGTGTGGCCGTGCTACGGGGGCCCCTCATCGTTGGCGCTGGACCAGCAGGGCTAGCATGCGCGGCGATGCTCACCATGGGATTGGTGCCCTACGTGATCCTGGAACGTGACATGTGCATCGCATCAACGTGGCACCGCCGCACGTACGATAGGCTGTGTTTGCACCTACCCAAGCGCTACTGCCAGCTGCCGCTCATGCCCTTCCCGCATAGCTACCCCACATACCCGGTTAGGCAGCAGTTTCTGGCCTACCTCGATGAGTACAAGCGAAAGCACGGCATCCGCCCCTTCTTCAACATGGAGGTTGTCAGCGCCGAGTACGACGGTGAGTATTGGTGCGTGCGCACCAAGGATACCAGCGACAATGTTGGAGGGTCTATGCTTTCCTCTTGCACTATGGAGTACCGCTCCAAATGGCTAATTGTGGCCACTGGTGAAAACGCTGAGCCGGTGGTACCTGAGATTAAGGGCATGCGAAGCTTCAAGGGTGAAGTCTTTCACTCAAGCGACTATCGCAACGGCGAGGAATTTCAAGGCAAAAATGTGCTCGTCATTGGTTGTGGCAACTCTGGCATGGAGGTGTCGCTGGATCTTGCCAACTACAATGTGCATACCTCTATGGTTGTGCGTGATTCGGGACACGTCCTTCCAAGAGAGATACTGGGAATCTCTACATTTACATTGTCCTTGTGGCTTCAGACATTTTTTAATATTAAAGTAGTGGATCAAATCCTTCTTGTACTAGCCTGGTTCATTCTAGGTGACACCAGGCGTATCGGTATTCCTCGACCTAATTTAGGTCCAATGGAACTAAAACAATTGTCTGGTAAGACACCGGTACTTGACGTTGGCACGATTGCAAAGATCAAATCCGGAGACATAAAAGTGTTTCCGGGAATTAAAAGTTTTCAAGAGGATGGTGTAGAGTTTATTGATGGTAGAATCGAATCATTCGATGTTGTTATTTTTGCAACTGGTTATAAAAGTAATGTTCCATATTGGTTGAAGGAAAATGAATTTTTTTCACGGAAAGATGGATTTCCATGTAGACCAAATGAGTGGAAAGGAAAGAATGGTCTATATGCTGCTGGATTCTCGAGACGTGGTCTACTTGGTGTTTCTATGGATGCAACTAAAATTGCAAATGATATTATACAATCTTATAATAACATAATATTTCACCCGATGGACATCCAACGATCACAAGACGATTAGAGGCCAGCTTAACAAGACAAGAGTTTTCTAGACGGAATCAGTAGTCGCACTCGTGCGTCTCGTTGGTGGAGTGATACATGCCGTTGAAATTTGGTCCATTGGATAGGGTGGAGAGCTGTTGACTTTTTCTTTaaaaaaaaTTCCAGTCTCTCATATGAAAATTTGTTTTTGCTTGTGATGTGATACATGCCATTGAAATTTGGCCCATTGGATATGGTGGAGAGTTGTTGACTTTTTCTTTAAAAAATTCCAGTCTCCCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.33382 translated coding region predicted by ESTScan from UniGene Zm.33382

ITIFKHIPSISREFERASIARAPSDMDRFITQTEGRRDRKHIPSVSREFAGASAARASPGMERSIAKSEVRWDRFVETGKXAMVQDPLTTETGGKMEHDLLMYSPRSAARATATGIPIGDQGVAVLRGPLIVGAGPAGLACAAMLTMGLVPYVILERDMCIASTWHRRTYDRLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPEIKGMRSFKGEVFHSSDYRNGEEFQGKNVLVIGCGNSGMEVSLDLANYNVHTSMVVRDSGHVLPREILGISTFTLSLWLQTFFNIKVVDQILLVLAWFILGDTRRIGIPRPNLGPMELKQLSGKTPVLDVGTIAKIKSGDIKVFPGIKSFQEDGVEFIDGRIESFDVVIFATGYKSNVPYWLKENEFFSRKDGFPCRPNEWKGKNGLYAAGFSRRGLLGVSMDATKIANDIIQSYNNIIFHPMDIQRSQDD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
127-510 MONOOXYGENASE,MONOOXYGENASE

RGPLIVGAGPAGLACAAMLTMGLVPYVILERDMCIASTWHRRTYDRLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPEIKGMRSFKGEVFHSSDYRNGEEFQGKNVLVIGCGNSGMEVSLDLANYNVHTSMVVRDSGHVLPREILGISTFTLSLWLQTFFNIKVVDQILLVLAWFILGDTRRIGIPRPNLGPMELKQLSGKTPVLDVGTIAKIKSGDIKVFPGIKSFQEDGVEFIDGRIESFDVVIFATGYKSNVPYWLKENEFFSRKDGFPCRPNEWKGKNGLYAAGFSRRGLLGVSMDATKIANDIIQSYN

HMMPanther: PTHR23023
127-510 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

RGPLIVGAGPAGLACAAMLTMGLVPYVILERDMCIASTWHRRTYDRLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPEIKGMRSFKGEVFHSSDYRNGEEFQGKNVLVIGCGNSGMEVSLDLANYNVHTSMVVRDSGHVLPREILGISTFTLSLWLQTFFNIKVVDQILLVLAWFILGDTRRIGIPRPNLGPMELKQLSGKTPVLDVGTIAKIKSGDIKVFPGIKSFQEDGVEFIDGRIESFDVVIFATGYKSNVPYWLKENEFFSRKDGFPCRPNEWKGKNGLYAAGFSRRGLLGVSMDATKIANDIIQSYN

FPrintScan: PR00368
IPR013027
129-148 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PLIVGAGPAGLACAAMLTMG

Gene3D: G3DSA:3.50.50.60
130-275 no description

LIVGAGPAGLACAAMLTMGLVPYVILERDMCIASTWHRRTYDRLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPE

superfamily: SSF51905
130-418 FAD/NAD(P)-binding domain

LIVGAGPAGLACAAMLTMGLVPYVILERDMCIASTWHRRTYDRLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPEIKGMRSFKGEVFHSSDYRNGEEFQGKNVLVIGCGNSGMEVSLDLANYNVHTSMVVRDSGHVLPREILGISTFTLSLWLQTFFNIKVVDQILLVLAWFILGDTRRIGIPRPNLGPMELKQLSGKTPVLDVGTIAKIKSGDIKVF

HMMPfam: PF00743
IPR020946
172-455 FMO-like
Flavin-containing monooxygenase-like

RLCLHLPKRYCQLPLMPFPHSYPTYPVRQQFLAYLDEYKRKHGIRPFFNMEVVSAEYDGEYWCVRTKDTSDNVGGSMLSSCTMEYRSKWLIVATGENAEPVVPEIKGMRSFKGEVFHSSDYRNGEEFQGKNVLVIGCGNSGMEVSLDLANYNVHTSMVVRDSGHVLPREILGISTFTLSLWLQTFFNIKVVDQILLVLAWFILGDTRRIGIPRPNLGPMELKQLSGKTPVLDVGTIAKIKSGDIKVFPGIKSFQEDGVEFIDGRIESFDVVIFATGYKSNVPYW

FPrintScan: PR00368
IPR013027
258-276 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

SKWLIVATGENAEPVVPEI

FPrintScan: PR00368
IPR013027
302-320 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

NVLVIGCGNSGMEVSLDLA

Gene3D: G3DSA:3.50.50.60
412-445 no description

SGDIKVFPGIKSFQEDGVEFIDGRIESFDVVIFA

superfamily: SSF51905
421-511 FAD/NAD(P)-binding domain

IKSFQEDGVEFIDGRIESFDVVIFATGYKSNVPYWLKENEFFSRKDGFPCRPNEWKGKNGLYAAGFSRRGLLGVSMDATKIANDIIQSYNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox