PRGDB00064212 (Zm.37240)

From PRG Wiki
Jump to: navigation, search
Zm.37240
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 149075080 (EE163564)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFc0134P09.f ZM_BFc Zea mays cDNA clone ZM_BFc0134P09 5', mRNA sequence

DNA Sequence

CATGGCGCGCAGATTCGTGCCTACCTCGGTGAAGCTCGGCCTCGCCGAGGGTTCGGCTGACCAGCACTGCTCCATCAGTGACCTCCACTGGGGGTCACAGGACTCGGGCACCGGAGGTCGCAGCGTGTTATTCACGATCCCACCTATAATGGCACCGTAGTGCAGTTCGGCGTAAGGCTCTTCACCCGTGAGTAGCTCCCACATCACGATGCCAAACGAGAAAACGTCAACCTTTTCAGAGACGAGGCTGCTGCTGCCATTCAACAACTCAGGGGCCATCCAAGGTAGTGTTCCTCTCACTCCACCAGAGATAAGTGTCTGGCATTTGACCTTTGATAATCCCAAATCACCAACCTTGCATATTGGTCGTTGAGGATACCTTAGGTTGACAAGCAGATTGTCACTGTTCAAGTCGAAATGCACTATATTCTTCCCATGGAGATATTCCATTCCAAAAGCAACATCCATTGCAATTAATAGACGTCTACGCCGATCAAAGATCCTGTTTTCATGTCTTTGCAATGCTTGTCGGAGTGAGCCATTAGCCATGTACTCCGTTACCGTTGCAACAGATCCACCAGGTCCATCTAGAACAACACCGTACAATGCTACTACGTTTGGATGGTGCAAAGATGCAAGCTTGTCTGCCTCATTCCAGAAATCAGTCCTCATACGCTCTTGCTCAGATGCCTTCCCAGCAAAACATCGCTCGTTGATTCTCTTTATAGCAACATCTGAGCCTCTCCACTTTCCATGGTACACAGTACCAATGGTTCCAGAACCCAGTTCCACGCATTCCTCAAGGTCACTGTTCTTTATTATCTGAAGTTTATCGATGT


Protein sequences

Name Description Sequence
Zm.37240 translated coding region predicted by ESTScan from UniGene Zm.37240

XIDKLQIIKNSDLEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNLRAM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257:SF393
6-280 SUBFAMILY NOT NAMED

QIIKNSDLEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNLRAM

HMMPanther: PTHR23257
6-280 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

QIIKNSDLEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNLRAM

superfamily: SSF56112
IPR011009
8-277 Protein kinase-like (PK-like)
Protein kinase-like domain

IKNSDLEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNL

Gene3D: G3DSA:3.30.200.20
9-97 no description

KNSDLEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEY

ProfileScan: PS50011
IPR000719
13-280 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNLRAM

HMMSmart: SM00219
IPR020635
13-277 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNL

HMMSmart: SM00220
IPR002290
13-280 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEECVELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTNLRAM

HMMPfam: PF07714
IPR001245
17-276 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VELGSGTIGTVYHGKWRGSDVAIKRINERCFAGKASEQERMRTDFWNEADKLASLHHPNVVALYGVVLDGPGGSVATVTEYMANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEVGTN

FPrintScan: PR00109
IPR001245
95-108 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYMANGSLRQALQ

Gene3D: G3DSA:1.10.510.10
98-273 no description

MANGSLRQALQRHENRIFDRRRRLLIAMDVAFGMEYLHGKNIVHFDLNSDNLLVNLRYPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLRPPVPESCDPQWRSLMEQCWSAEPSARPSFTEV

FPrintScan: PR00109
IPR001245
133-151 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHGKNIVHFDLNSDNLLV

FPrintScan: PR00109
IPR001245
204-226 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVFSFGIVMWELLTGEEPYAEL

FPrintScan: PR00109
IPR001245
248-270 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDPQWRSLMEQCWSAEPSARPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox