PRGDB00064215 (Zm.37493)

From PRG Wiki
Jump to: navigation, search
Zm.37493
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224030892 (BT067625)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0104B15 mRNA, complete cds

DNA Sequence

TTTTACATGTCGCCCTTCTTCATCCTCCCAACACTCAAGGCCACAAACCAAATGCTGCTAACTACTCCAGCTAGCTAGCAACAATAATGGCGGCCTGCCGTCCCTCCGGCCTCAGCGTCTTGTGCAGCCTCTACCGTCTCTACATCTGCATGCTGTTCATCCATGTCCCTCGGGCTCACTCGCTGTCCTTCGACCTCAGCTTCTCCAAACCCCAGAGCCCAGACCTCTCCTCCCAGAAGATAAACTTCAACGGCGACGCGTACCCCACTCCAGAAACGCTCGAGCTGACGCGAAACCAGCATGACCAAAGCAGCACCAACAGCATCGGCCGGGCGACGTACGCGCAGCCGGTGCCGCTGTGGGATGGCGCCACCGGCGAGACGGCCAGCTTCACCACCACCTTCACCTTCCGGATCAGGCCGGACTCGTGGAGCCCGTACCCCGGCGACGGGATGGCGTTCTTCCTCGGCCACTACGGGTCAGATATCCCCGTCCAGAGCGGCGGCGGCATGCTCGGCCTCGTCCCGACCCACACCAACGGCACCGGAAACGGCACCGTCGTCGCCGTCGAGTTCGACACCTTCCAGAACCCGACGAACGACGACATCAGCAGCAACCACGTGGGCATCGACGTCGACTCCCTCAACTCCACGGCGTCCACGGACACCACCTCGCCGACCAAGAACCTCACGTCCGGTTACCTGATGGCGGCCACCGTAAGGTACGAGAACGTCACCAGGTTGCTCGCCTTGGAGCTCACCGTCAACGACACGTCCTACTACGTCAACGCAACTGTCGATCTCAAGGGCTACCTACCGGAGCGTGTAGCCGTCGGCTTCTCCGCGGCGACTGGAAATGGCGGCGAGCAGCACCAGGTGCTGTCATGGTCATTCACGTCCACTCTGCCGGAACCACCGGCACCGGCACCGGCACCGCCGCCGCATGCGACACCAGACAACAACCAGCCTCCCAAGAAGAAGAGATCAGTCGGGACCACGGGCCTGATAATCGCCGTGCTTGTGCCTCTGCTATCTCTCCTGGCGTGTGCGGCAGGCGTGCTGGCAAGGCGAAAACTCAGGGgaagaagaagaagaagaCCGCCAAACGGTAGCAGCGACGACGACAACGATTACCAAGAACAGGACAACGGCAGCAGGGCGGAGCTCGAGAGAGGAGTGGCTGCCACCGGCCCCCGGCGGTACGCGTACCGCGACCTGGCCGCCGCCACCGACAACTTCGCCGAGGACGGCAAGCTCGGTCGCGGTGGCTTCGGGAGCGTCTACAGGGGCAAACTCACCGTCGCCGGCGAAGAGCGGCCCGTGGCGATCAAGGTGTTGTCGTCGGAGTCGTCGGCGCAGGGCAGGAAGGAGTTCGAGGCGGAGGTGAGGATCATCAGCCGGCTCAAGCATCGCAACCTCGTGCAGCTCCTGGGCTGGTGCGACAGCCGGCACGGCCTCCTGCTCGTCTACGAGCTGGTGGCCCAGGGCAGCCTCGACAGGCATCTCCACGGCAGCGAGCGCTTCTTGGCGTGGCCGGACAGGCACCAGATCATCCTCGGCCTGGGGTCGGCGCTGCGGTACCTCCACCAGGAGTGGGAGCAGCGCGTGGTGCACGGCGACATCAAGCCCAGCAACATCATGCTGGACGACTCGCTGGGCGCCAAGCTCGGCGACTTCGGCCTGGCCCGGCTCGGAGACCACGGCGGGCGCTGGCACACCACCAAGGCCGTGCTCGGCACCGCGGGGTACATCGACCCGGAGTTCGTCAACACGCGCCACCCGAGCACCCACGCCGACGTGTACAGCTTCGGCATCGTCCTCCTCGAGGTCGTCTCCGGCCGGTCCCCGGTGGTCCTGCTGCCCGGCGAGCCGCCCTTCGTTCTGCTCAAGTGGGTGTGGGGCCTGTACGGACGGAACGCGGTCCTCGACGCGGCGGACGAGCAGCTGAGGGGCGGCGGCGACGACGACGAGTGCATCGAGAGGGCACTCGTCGTCGGGCTCTGGTGCGCCCACCCTGAGCAGAGCGAGCGGCCGTCCATCGCGCAGGCCATGCACGTCCTGCAGTCGGCGGACGCCAGGCTGCCGGCGCTCCCGCCGCAGATGTACAAGACGGCGTCGGACCTCGCCGTCACCGGACGTTCCTACGGCGTTTTGTCCGTGGAAAGCTACAGCGGCGGTGACTCCTCTACGACGACTACGACCGCCGGCTACTCCAAAACTTCTTCAGGCTCGTCGACCACGGCCTTGCTCCGAGATTCAAAAGAGAGACCTTGATTCTGCaaaaataaaataaaaaatcctatgtgggagctgaactgtaaaaaaaaTGTGTTTTCAGTTTTGTTAATTTGGGCTGAAGCCTGAAGCTAACACTTTCAGTTTTGAATCTTCCTTCACACCGGTTGTCCATATTTCTTTTGCGGCAATAGAAAAATTCAG


Protein sequences

Name Description Sequence
Zm.37493 translated coding region predicted by ESTScan from UniGene Zm.37493

MAACRPSGLSVLCSLYRLYICMLFIHVPRAHSLSFDLSFSKPQSPDLSSQKINFNGDAYPTPETLELTRNQHDQSSTNSIGRATYAQPVPLWDGATGETASFTTTFTFRIRPDSWSPYPGDGMAFFLGHYGSDIPVQSGGGMLGLVPTHTNGTGNGTVVAVEFDTFQNPTNDDISSNHVGIDVDSLNSTASTDTTSPTKNLTSGYLMAATVRYENVTRLLALELTVNDTSYYVNATVDLKGYLPERVAVGFSAATGNGGEQHQVLSWSFTSTLPEPPAPAPAPPPHATPDNNQPPKKKRSVGTTGLIIAVLVPLLSLLACAAGVLARRKLRGRRRRRPPNGSSDDDNDYQEQDNGSRAELERGVAATGPRRYAYRDLAAATDNFAEDGKLGRGGFGSVYRGKLTVAGEEXARGDQGVVVGVVGAGQEGVRGGGEDHQPAQASQPRAAPGLVRQPARPPARLRAGGPGQPRQASPRQRALLGVAGQAPDHPRPGVGAAVPPPGVGAARGARRHQAQQHHAGRLAGAKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVLQSADARLPALPPQMYKTASDLAVTGRSYGVLSVESYSGGDSSTTTTTAGYSKTSSGSSTTALLRDSKERP

Domains

Domain Start-End Description Sequence

superfamily: SSF49899
IPR008985
36-273 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

DLSFSKPQSPDLSSQKINFNGDAYPTPETLELTRNQHDQSSTNSIGRATYAQPVPLWDGATGETASFTTTFTFRIRPDSWSPYPGDGMAFFLGHYGSDIPVQSGGGMLGLVPTHTNGTGNGTVVAVEFDTFQNPTNDDISSNHVGIDVDSLNSTASTDTTSPTKNLTSGYLMAATVRYENVTRLLALELTVNDTSYYVNATVDLKGYLPERVAVGFSAATGNGGEQHQVLSWSFTSTL

Gene3D: G3DSA:2.60.120.200
IPR013320
36-278 no description
Concanavalin A-like lectin/glucanase, subgroup

DLSFSKPQSPDLSSQKINFNGDAYPTPETLELTRNQHDQSSTNSIGRATYAQPVPLWDGATGETASFTTTFTFRIRPDSWSPYPGDGMAFFLGHYGSDIPVQSGGGMLGLVPTHTNGTGNGTVVAVEFDTFQNPTNDDISSNHVGIDVDSLNSTASTDTTSPTKNLTSGYLMAATVRYENVTRLLALELTVNDTSYYVNATVDLKGYLPERVAVGFSAATGNGGEQHQVLSWSFTSTLPEPPA

HMMPfam: PF00139
IPR001220
45-270 Lectin_legB
Legume lectin, beta chain

PDLSSQKINFNGDAYPTPETLELTRNQHDQSSTNSIGRATYAQPVPLWDGATGETASFTTTFTFRIRPDSWSPYPGDGMAFFLGHYGSDIPVQSGGGMLGLVPTHTNGTGNGTVVAVEFDTFQNPTNDDISSNHVGIDVDSLNSTASTDTTSPTKNLTSGYLMAATVRYENVTRLLALELTVNDTSYYVNATVDLKGYLPERVAVGFSAATGNGGEQHQVLSWSFT

Seg: seg
102-108 seg

FTTTFTF

Seg: seg
150-159 seg

TNGTGNGTVV

PatternScan: PS00307
IPR019825
159-165 LECTIN_LEGUME_BETA
Legume lectin, beta chain, Mn/Ca-binding site

VAVEFDT

PatternScan: PS00308
IPR000985
243-252 LECTIN_LEGUME_ALPHA
Legume lectin, alpha chain, conserved site

LPERVAVGFS

Seg: seg
274-289 seg

PEPPAPAPAPPPHATP

Seg: seg
327-337 seg

RRKLRGRRRRR

Gene3D: G3DSA:3.30.200.20
368-405 no description

GPRRYAYRDLAAATDNFAEDGKLGRGGFGSVYRGKLTV

superfamily: SSF56112
IPR011009
370-411 Protein kinase-like (PK-like)
Protein kinase-like domain

RRYAYRDLAAATDNFAEDGKLGRGGFGSVYRGKLTVAGEEXA

ProfileScan: PS50011
IPR000719
384-668 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAEDGKLGRGGFGSVYRGKLTVAGEEXARGDQGVVVGVVGAGQEGVRGGGEDHQPAQASQPRAAPGLVRQPARPPARLRAGGPGQPRQASPRQRALLGVAGQAPDHPRPGVGAAVPPPGVGAARGARRHQAQQHHAGRLAGAKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVLQSADARLPAL

HMMSmart: SM00220
IPR002290
384-658 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAEDGKLGRGGFGSVYRGKLTVAGEEXARGDQGVVVGVVGAGQEGVRGGGEDHQPAQASQPRAAPGLVRQPARPPARLRAGGPGQPRQASPRQRALLGVAGQAPDHPRPGVGAAVPPPGVGAARGARRHQAQQHHAGRLAGAKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVL

Seg: seg
411-435 seg

ARGDQGVVVGVVGAGQEGVRGGGED

Seg: seg
437-448 seg

QPAQASQPRAAP

Seg: seg
452-471 seg

RQPARPPARLRAGGPGQPRQ

Seg: seg
490-525 seg

PRPGVGAAVPPPGVGAARGARRHQAQQHHAGRLAGA

superfamily: SSF56112
IPR011009
525-666 Protein kinase-like (PK-like)
Protein kinase-like domain

AKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVLQSADARLP

HMMPfam: PF00069
IPR017442
525-588 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPV

Gene3D: G3DSA:1.10.510.10
525-658 no description

AKLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVL

HMMPanther: PTHR24420:SF568
526-725 OS09G0341100 PROTEIN

KLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVLQSADARLPALPPQMYKTASDLAVTGRSYGVLSVESYSGGDSSTTTTTAGYSKTSSGSSTTALLRDSK

HMMPanther: PTHR24420
526-725 FAMILY NOT NAMED,FAMILY NOT NAMED

KLGDFGLARLGDHGGRWHTTKAVLGTAGYIDPEFVNTRHPSTHADVYSFGIVLLEVVSGRSPVVLLPGEPPFVLLKWVWGLYGRNAVLDAADEQLRGGGDDDECIERALVVGLWCAHPEQSERPSIAQAMHVLQSADARLPALPPQMYKTASDLAVTGRSYGVLSVESYSGGDSSTTTTTAGYSKTSSGSSTTALLRDSK

Seg: seg
693-718 seg

SYSGGDSSTTTTTAGYSKTSSGSSTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox