PRGDB00064228 (Zm.40444)

From PRG Wiki
Jump to: navigation, search
Zm.40444
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195620815 (EU960120)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 221950 dihydroflavonol-4-reductase mRNA, complete cds

DNA Sequence

ACTACGTAGCTGCCTGTGCCTCTTTCTGGCTCCCTGCTGTCTGCCTGGCCGGTGCTCACAGACACGCGCAAGATGGCCGGACGCACGGAGGAGGCTCGCAGGAGCGGGGAGAGGGAGACGGTGTGCGTGACGGGCGCCGGCGGGTACATCGCCTCATGGCTCGTCAAGCTCCTCCTCTCCCGCGGCTACGCCGTGCACGCCACCGTCCGTGACCCGCGTGATCCCAAGAACGCCCACCTGGGGCAGCTGGAATGGGCCGCGGAGAATCTCCGGCTGTTCAAGGCCGACGTGCTCGACAGCGACGCGCTGGCTGCCGCAGTCTCCGGGTGCCGGGGGGTCTTCCATGTTGCCTGTCCGGTGCCCACGGATAGGGTTCTTGATCCGGAGTCAGAAGTACTGGCTCCTGCTGTGCAAGGTACCTTAAACATTCTTCAGGCTTGCTCAGCTAATAATATTCAGAAGGTTGTTGTGGTTTCGTCTACCGCCGCTGTTCATTTCGACCCAAATTGGCCTCCACATAGACCTAAAGACGAGGATTGCTGGTCGGACATAAACTTTTGCAAAAAGAACGAGGACTGGTATATGGTTGCCAAGGTTATTGCTGAAAAGACAGCCCTAGAATACGGAGAGAGAAATGGATTAAATGTTGTTACAGTTTGCCCTACTATGGCTTTAGGACCGCTCTTGCGGCCTATGCTCAATGTCAGCCATGAATTCCTCATGTACATTATTAAAGGAGGTCCTACTATGATGAAGAACATTCCATGGCACATAGTTGATGTCCGAGATGTGGTTGATGCTTTGCTTATGGTATACAAGAAAGAGGAATCGACAGGGAGATACATCTGTGCACCAAATTGCATCAGTGCAAAAGATCTGGTGAACATGCTGAAGAGGGATTATCCTAATTACAATTATGTAAACTGCGACAATGATATGGTGCTTAACTCTATAGTTACACCACTTATGTCGGAGAAACTGAAGAATTTGGGCTGGAAACCAATGAAGACACTAGAGGAAACATTATTGGATAGTGTTGAATGCTATAAGAAGATGGGGCTTCTAAAAGATGCTGAGGGATGCCCTTGTCGTCTTCCTCACCTTTTTCATATGGCTATAGAAAAATGAAGAATACTCACCATTGCTTCTTGTGTTACCTAATTACTCTTTGAACATTGTTGGGTATGTGTTCTAATCACACACCAATAATGTTGACATTCAATGGGTTGTGGTTGATTTGAAATAAATGTTTGGTTTCTTATGTAATCTATATGGAACAAAGTGCACCTTTCACTTTTTTTGTATGGAAGTTGTCATGCATCTTTTTTCTCGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.40444 translated coding region predicted by ESTScan from UniGene Zm.40444

TTXLPVPLSGSLLSAWPVLTDTRKMAGRTEEARRSGERETVCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTMMKNIPWHIVDVRDVVDALLMVYKKEESTGRYICAPNCISAKDLVNMLKRDYPNYNYVNCDNDMVLNSIVTPLMSEKLKNLGWKPMKTLEETLLDSVECYKKMGLLKDAEGCPCRLPHLFHMAIEK

Domains

Domain Start-End Description Sequence

Seg: seg
8-14 seg

LSGSLLS

HMMPanther: PTHR10366:SF74
23-375 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RKMAGRTEEARRSGERETVCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTMMKNIPWHIVDVRDVVDALLMVYKKEESTGRYICAPNCISAKDLVNMLKRDYPNYNYVNCDNDMVLNSIVTPLMSEKLKNLGWKPMKTLEETLLDSVECYKKMGLLKDAEGCPCRLPHLFHMAIEK

HMMPanther: PTHR10366
23-375 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

RKMAGRTEEARRSGERETVCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTMMKNIPWHIVDVRDVVDALLMVYKKEESTGRYICAPNCISAKDLVNMLKRDYPNYNYVNCDNDMVLNSIVTPLMSEKLKNLGWKPMKTLEETLLDSVECYKKMGLLKDAEGCPCRLPHLFHMAIEK

Gene3D: G3DSA:3.40.50.720
IPR016040
39-250 no description
NAD(P)-binding domain

ETVCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTM

superfamily: SSF51735
39-351 NAD(P)-binding Rossmann-fold domains

ETVCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTMMKNIPWHIVDVRDVVDALLMVYKKEESTGRYICAPNCISAKDLVNMLKRDYPNYNYVNCDNDMVLNSIVTPLMSEKLKNLGWKPMKTLEETLLDSVECYKK

HMMPfam: PF01370
IPR001509
41-281 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGYIASWLVKLLLSRGYAVHATVRDPRDPKNAHLGQLEWAAENLRLFKADVLDSDALAAAVSGCRGVFHVACPVPTDRVLDPESEVLAPAVQGTLNILQACSANNIQKVVVVSSTAAVHFDPNWPPHRPKDEDCWSDINFCKKNEDWYMVAKVIAEKTALEYGERNGLNVVTVCPTMALGPLLRPMLNVSHEFLMYIIKGGPTMMKNIPWHIVDVRDVVDALLMVYKKEESTGRY

Seg: seg
95-108 seg

ADVLDSDALAAAVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox