PRGDB00064232 (Zm.41032)

From PRG Wiki
Jump to: navigation, search
Zm.41032
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71774494 (DR972372)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

ZM_BFb0095I05.f ZM_BFb Zea mays cDNA 3', mRNA sequence

DNA Sequence

GCCCAATACCAAACTCGGTCCAATTTTGATGCTTACAATTACATATTGCCAACCAGAATGTTAGGAGCAAATTCAGCGTAGCCCTACCGTAATCGCTCTACAATCTGTAGTAAACCTGGAATGGACGACAGAAGCAGGCATTCTGCCTGAGTGCGTGTATCCAGATGATGATCTCTGCCATGGATGGATGAGGATGACGATGACGCAGACGCACATTTTACATCGTCATGTACGGCTGCGGCGACAGCAGCTGCCGCGTCACCCGGTCACGGTTCCTAGCCGACTCGGAGCGTCCCAACGCCATCTCCTGCTCTAGGTTCGGCGACGTCGAGGGCGCGACCGGGGGCGCCGCCGACGAGGCGACTGTCGAGACCATGCTGGAGTTGCCGCCGCTGGCCGTGGTGGTGCTAAAAAAGCTGTCCGACGACTTCGGGGGCGGAGGCCTCTCGAGCTCCATAACCCCATCCAGCATCTGCACCACCTTCCCCATGGACGGGCGCTGCCCCGGCTGCTCCTGGATGCACCAGAAGCTCACCTGCAGCGCGCGCTCCACCTGCGCCATGTCGAGGTCCTCTGCGGGGAGCCTCCTGTCGATGATGCCGGCGAGGTTGCCCCTCTCGTACTCCTCGTACGCCCACACCGAGAACTTCTTCCCGCGCGTCTCCTCCGACACGTCGAAGTTGCGTCGCCCGCTGACGGTCTCCAGCAACACCATCCCGTAGCTGTACACGTCGGACTTGGGCGTTATGGGCAGGTTGGCG


Protein sequences

Name Description Sequence
Zm.41032 translated coding region predicted by ESTScan from UniGene Zm.41032

XANLPITPKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYERGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQMLDGVMELERPPPPKSSDSFFSTTTASGGNSSMVSTVASSAAPPVAPSTSPNLEQEMALGRSESARNRDXGDAAAAVAAAVHDDVKCASASSSSSSIHGRDHHLDTRTQAECLLLSSIPGLLQIVERLRXGYAEFAPNILVGNM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-180 FAMILY NOT NAMED,FAMILY NOT NAMED

ANLPITPKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYERGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQMLDGVMELERPPPPKSSDSFFSTTTASGGNSSMVSTVASSAAPPVAPSTSPNLEQEMALGRSESARNRDXGDAAAAVAAAVHD

HMMPanther: PTHR24420:SF814
2-180 SUBFAMILY NOT NAMED

ANLPITPKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYERGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQMLDGVMELERPPPPKSSDSFFSTTTASGGNSSMVSTVASSAAPPVAPSTSPNLEQEMALGRSESARNRDXGDAAAAVAAAVHD

superfamily: SSF56112
IPR011009
4-99 Protein kinase-like (PK-like)
Protein kinase-like domain

LPITPKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYERGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQML

Gene3D: G3DSA:1.10.510.10
5-120 no description

PITPKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYERGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQMLDGVMELERPPPPKSSDSFFST

Seg: seg
113-148 seg

SSDSFFSTTTASGGNSSMVSTVASSAAPPVAPSTSP

Seg: seg
169-182 seg

DAAAAVAAAVHDDV

Seg: seg
185-193 seg

ASASSSSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox