PRGDB00064244 (Zm.48735)

From PRG Wiki
Jump to: navigation, search
Zm.48735
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224033218 (BT068788)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0008H03 mRNA, complete cds

DNA Sequence

CTCTCTGACCCTCACTCGCTCCCTGTCACACACACTACACTCGCAATTCATCCGCAGTCACAAGCTCGGCTGCTGCTCCCGCTAACGGTTGAGGCGTTGCTGGTGCACACAGGAAGGGAAGGGAAGGGAGAGCTGCACACAGCTTTGCTCTGGCTCTTGGCTCCCCTGTCCAGCTGTCCTGTCCGTCCATCATGGAGGAAACGCCCAGCCCGCAGCTCTAGCCGCCGTCAATCTCGTCTCGTATCGGAGTCGAAGGAAGTAAGAGGCGGGATGGCATGAAGCGACCTACCAAGAATGAGAGGCTGGGCAACCCCCGGCACAAGTAGGAGGAAGAACCCGAGCAACCGAGCCACAGGGAGGAGGAGGAGATGGGCAACTGCGGCACACGGGAGGAGAATGCCGTCGTCGCTGCGCACGCGCAAGCCTTCCAAGAACGCCAATGCAGATAGGAAGCACACCTGCATGTCATCAGATATAAGTGACCCTTCCACACCTAGGAAAGTTGAAGATGCCAAGAACATTTCCATATACAACGATGTGATTGCCTTCACATTGTTTGAGCTAGAGACAATCACAAAGAGCTTCCGTGTTGATTATGTTCTTGGCGAAGGAGGATTTGGGACCGTTTACAAGGGTTACATAGATGAAAATGTCAGGGTTGGGCTGAAGTCACTGCCTGTTGCAGTCAAGGTGCTCAACAAAGATGGACATCAAGGGCACAGAGAATGGCTTACCGAGGTTAACTGCCTGGGGCAGTTGAGGCATCCAAATTTGGTGAAGTTGATCGGATATTGCTGCGAAGATGACCATCGGCTGCTTGTCTACGAGTTCATGTTTCGAGGAAGTCTAGAAAACCACTTATTCCGAAAGACAGCTACGCCATTGCCCTGGGGTACTAGGATGTCAATCGCGCTGGGAGCCGCTAAAGGGCTCGCTTGCCTCCACAACGCTCAAAGGCCCGTCATCTACAGAGATTTCAAGACATCAAACATTCTGCTGGACTCCGATTATACTGCCAAACTGTCTGACTTTGGCCTCGCAAAAGATGGCCCTGAAGGTGATCAGACGCATGTGTCGACACGGGTGATGGGAACCTACGGTTATGCTGCCCCTGAATATGTGATGACCGGTCACTTGACTGCTCGGAGTGACGTGTACAGCTTCGGCGTGGTCCTGCTGGAGCTCCTGACGGGGCGCAAGTCGATCGACAAGTCGCGGCCCAGCAGGGAGCAGAGCCTGGTGGACTGGGCGCTCCCGAAGCTCAACGACAAGAGGAGGCTCCTCCAGATCATCGACCCGAGGCTGGAGGGGCAGTACTCGGCCAGAGCCGCTCACAAGTCCTGCAGCCTCGCGTTCTACTGCCTGAGCCAGAACCCCAAGGCCAGGCCGCTCATGAGCGACGTCGTCGAGACCCTCGCGCCGTTGCAGCAGGGCGGCGGCGGCGGCAGCGACGCGTCCTCCGGCCTTCCTGACTGCAGAGGCCGCCGCAGGCTGACCGGCAACAGCGTCGTCCACTTCAGGGCCATCCCCAACCCCAAGTGCACGCCTGTTGTCCCGGCTTGCAGAGTGCGGTGATGTTGCTGCGCTTCGGTTGAAGCTGCTGGGATAGGTTCAGTGCAAagggactagagccttgctgatggggaacggatcacatgcgcgtgttcttggtgttggtacagtcattctgaagtttacttcgggaaagacggtgctattgaagaacgtgcagcatgtcccctccatcaaaaagaatctagttagtggctctcaattgtgtcgagatggctacaaaattgtctttgagtctaataaatgtatactgtcTAAGTATGGAACGTTTGTTGGAAAAGGCTATGACAGCGGAGGCTTGTTCCGCTTATCTTTGCATGATGCGTGTAATAAGTCTGTGAACAATGTTGTTTCGAATGAGTCGTATATTTGGCATTCACGAC


Protein sequences

Name Description Sequence
Zm.48735 translated coding region predicted by ESTScan from UniGene Zm.48735

LSDPHSLPVTHTTLAIHPQSQARLLLPLTVEALLVHTGREGKGELHTALLWLLAPLSSCPVRPSWRKRPARSSSRRQSRLVSESKEVRGGMAXSDLPRMRGWATPGTSRRKNPSNRATGRRRRWATAAHGRRMPSSLRTRKPSKNANADRKHTCMSSDISDPSTPRKVEDAKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQQGGGGGSDASSGLPDCRGRRRLTGNSVVHFRAIPNPKCTPVVPACRVRXCCCASVEAAGKVQCKGTRALLMGNGSHARVLGVGTVILKFTSGKTVLLKNVQHVPSIKKNLVSGSQLCRDGYKIVFESNKCILSKYGTFVGKGYDSGGLFRLSLHDACNKSVNNVVSNESYIWHSRX

Domains

Domain Start-End Description Sequence

Seg: seg
24-34 seg

LLLPLTVEALL

Seg: seg
45-56 seg

LHTALLWLLAPL

Seg: seg
62-84 seg

RPSWRKRPARSSSRRQSRLVSES

Seg: seg
116-132 seg

RATGRRRRWATAAHGRR

HMMPanther: PTHR24420
161-477 FAMILY NOT NAMED,FAMILY NOT NAMED

DPSTPRKVEDAKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQQ

HMMPanther: PTHR24420:SF881
161-477 SUBFAMILY NOT NAMED

DPSTPRKVEDAKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQQ

superfamily: SSF56112
IPR011009
165-472 Protein kinase-like (PK-like)
Protein kinase-like domain

PRKVEDAKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETL

Gene3D: G3DSA:3.30.200.20
178-264 no description

NDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGY

ProfileScan: PS50011
IPR000719
195-476 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQ

HMMSmart: SM00220
IPR002290
195-475 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPL

HMMSmart: SM00219
IPR020635
195-472 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETL

HMMPfam: PF07714
IPR001245
198-472 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVETL

PatternScan: PS00107
IPR017441
201-230 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGTVYKGYIDENVRVGLKSLPVAVK

Gene3D: G3DSA:1.10.510.10
265-471 no description

CCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQNPKARPLMSDVVET

PatternScan: PS00108
IPR008271
321-333 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKTSNILL

Seg: seg
472-491 seg

LAPLQQGGGGGSDASSGLPD

Seg: seg
516-534 seg

PVVPACRVRXCCCASVEAA

Seg: seg
636-645 seg

SVNNVVSNES






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox