PRGDB00064245 (Zm.60416)

From PRG Wiki
Jump to: navigation, search
Zm.60416
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195648053 (EU971377)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 363214 STE20

DNA Sequence

AGCCTACACGCCCCCGCCTCCTGCCCTCTGTCCACATCCTCGCCTCTCCCCACTAGTTCGCTCGCGTGATGGTGGTGCGGGAGCAGCGGAACAAGGGTTCGTCGTCGGCCACCCTGTGACACCCCGCCCACGCCCCCGCGGCGGAACCTGCAAACCCGGAGGCCGGAGCTCCGACTTCGTCGGCCATCGACCGCGTCTGATCGGCGCTGGGACCTGCCGTCCGGACGAAATCGGTCAGCATGACGGGGCCCAATGAGAAGGCGGCGGCGGGAGGCGGGGGTGGCGAGAGGCGCAAGTACCCGATCCACGTGGAGGACTACGAGCTGTACGAGGAGATCGGGCAGGGCGTCAGCGCCATCGTGTACCGCGCACTCTGCAAGCCACTCGACGAGATCGTCGCCGTCAAGGTGGTCGACTTCGAGCGCACCAACAGCGACCTGAACAACATCGTTCGTGAAGCTCAGACAATGATTTTGATAGACCATCCTAACGTTGTCAAGGCGCATTGTTCATTTGCAAAAGACCAAACGTTATGGGTGGTTATGCCGTATATGGCTGGGGGGTCCTGTCTTCACATAATGAAATCAGTGCATCCTACTGGATTCGAGGAACCCATCATCGCGACTATACTTCGTGAAGTCCTGAAAGGTTTAGAGTATCTTCACCATCATGGCTCTATACATCGAGATGTGAAGGCAGGAAATATTCTAGTCGATTCTCGGGGTGGAATTAAACTTGGGGACTTTGGAGTCTCTGCTTGCCTTTTTGATTCTGGTGATAGACAGAGGGCCAGGAATACTTTTGTGGGAACACCTTGCTGGATGGCGCCCGAGGTTATGGAGCAACTACATGGATATGATTTCAGAGCAGACATATGGTCCTTTGGAATTACTGCACTTGAACTTGCTCATGGTCATGCTCCTTTCTCTAAGTACCCTCCCATGAAGGTCTTGCTCATGACACTTCAGAATGCTCCTCCAGGTCTTGACTATGAAAGAGATAAGAAATTCACGAGGAACTTCAAGCAAATGGTTGCTATGTGTTTGGTAAAAGACCCTTCAAAGAGGCCTTCGGCAAAAAAGTTGTTGAAGCAACCATTTTTCAAGCAAGCTCGTTCCACTGATTTTATTGCACGAAAGCTTTTAGAAGGATTGCCTGGCCTTGGTGTTAGATATCAAGCTTTGAAGGAAAAGGATCAACATTTAATGGCTCAAAAGAAAATGTCTGATGGAAAGAAAGAAGAAATCTCGCAGGATGAATACAAAAGGGGTATCAGCAGCTGGACCTTTGACATGGATGACCTGAGATCTCAAGCTTCATTGGGCACAGAATGTGAAGACAGTACCTTATGCAAAGATTCAGATATATCTTTCTATGACTTGGACAGTTTACAGGATCAAGCACCAGAAGGGCCACACTTGTTGAGAGATTTCTCAACGAAGTATGATGCTGACATTGAAAATGATATGACAACCAAAGATAAGTCAGCCGTTTCATCTCCTGATCAGCCTGCTAGCTTAGTGAGGAATGCTTCTATGCGTGGGATGCCCATAAACGGTTCTTTCAGGAAAGACAACTCTACAGAAAGCTTCGATTTGGAATGTCAAGAGAAACATCTGGACATTGTTCCGACTAGCTCATCCCCTGAAAGGAAGTTTTCTTTTAGTTCTTGCTCATCAAATGGGCTCCTTTTGTCCAAAGAGAGCTCTAAACAGCAAACTAGCATCCACAACCTTGACAAGTGTAATGGAGGGCATTTGCATGTATCAGATGAAACATCTTCTGAAGCTGCTCCTAAGACACATAAATCAGCAGAGGACCATGATGATAGATCCAAACCTCCACTTATAAGAGGTCGATTTAGAGTTATACCTGGGCATGTTGACTCAAAGGCTCAACCACCTGGCCTACAGAAGTGTCACAGCATGCAGACAATTTCTCGCCTTCCATCATTAAGTATACCCTCTTCCGCAGAAGTTGCATCAACCATTATTGGTGGCTCCTTCTACATGCAGCTATATAGTATTCTACAGACAAATATGCTTCAGAGGGACCAAATACTTAACGCGATGAAGCAGGTGAGTGGTTGTGCTATGGCTTCACCAGGCGTACCTTCTATGGCTTCACCGTGTATCCCTTCCACAAGTCGCTCGACATCTCCATCAGGTGTACCATCAGTTGACAGATCCATGCTGGAAGCTGCACAAGAAAGGGAGAAAGAGCTGCTGAATGAGGTCTTGGAGCTGCAATGGCGGTTATTGTGCACACAAGATGAGGTTCAGAAGCTTAAAGCAAAGGCAGCGCAGATCTGATGCTGAAGCTGTTAAGGGAGCATTAAGGGCGCGTCATGATAAGATGATCTGTTCATGCGGTTTTCAAATGGCTATTTAGCATAGGAGAGAGATACAAAATTAAGGATTGGTGTATATTTAAAAAGGTGCTAGTGATGCTCGAGTGTCCAATCCTGTCTAAGCAGGACATTAATTTCGTACAATCTGTGTGTTTGTGTTTATGGGTGGCATGGCGCTGTGTTTTTGTTGGAGCGCAATTCCCAGGTTGGGACTTGGGAAAGATAGCTTAACATGCCTATGGGTTTTAATaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.60416 translated coding region predicted by ESTScan from UniGene Zm.60416

XAYTPPPPALCPHPRLSPLVRSRDGGAGAAEQGFVVGHPVTPRPRPRGGTCKPGGRSSDFVGHRPRLIGAGTCRPDEIGQHDGANEKAAAGGGGGERRKYPIHVEDYELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFFKQARSTDFIARKLLEGLPGLGVRYQALKEKDQHLMAQKKMSDGKKEEISQDEYKRGISSWTFDMDDLRSQASLGTECEDSTLCKDSDISFYDLDSLQDQAPEGPHLLRDFSTKYDADIENDMTTKDKSAVSSPDQPASLVRNASMRGMPINGSFRKDNSTESFDLECQEKHLDIVPTSSSPERKFSFSSCSSNGLLLSKESSKQQTSIHNLDKCNGGHLHVSDETSSEAAPKTHKSAEDHDDRSKPPLIRGRFRVIPGHVDSKAQPPGLQKCHSMQTISRLPSLSIPSSAEVASTIIGGSFYMQLYSILQTNMLQRDQILNAMKQVSGCAMASPGVPSMASPCIPSTSRSTSPSGVPSVDRSMLEAAQEREKELLNEVLELQWRLLCTQDEVQKLKAKAAQI

Domains

Domain Start-End Description Sequence

Seg: seg
5-18 seg

PPPPALCPHPRLSP

Seg: seg
42-56 seg

PRPRPRGGTCKPGGR

Seg: seg
88-95 seg

AAAGGGGG

HMMPanther: PTHR24361:SF72
89-759 SUBFAMILY NOT NAMED

AAGGGGGERRKYPIHVEDYELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFFKQARSTDFIARKLLEGLPGLGVRYQALKEKDQHLMAQKKMSDGKKEEISQDEYKRGISSWTFDMDDLRSQASLGTECEDSTLCKDSDISFYDLDSLQDQAPEGPHLLRDFSTKYDADIENDMTTKDKSAVSSPDQPASLVRNASMRGMPINGSFRKDNSTESFDLECQEKHLDIVPTSSSPERKFSFSSCSSNGLLLSKESSKQQTSIHNLDKCNGGHLHVSDETSSEAAPKTHKSAEDHDDRSKPPLIRGRFRVIPGHVDSKAQPPGLQKCHSMQTISRLPSLSIPSSAEVASTIIGGSFYMQLYSILQTNMLQRDQILNAMKQVSGCAMASPGVPSMASPCIPSTSRSTSPSGVPSVDRSMLEAAQEREKELLNEVLELQWRLLCTQDE

HMMPanther: PTHR24361
89-759 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

AAGGGGGERRKYPIHVEDYELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFFKQARSTDFIARKLLEGLPGLGVRYQALKEKDQHLMAQKKMSDGKKEEISQDEYKRGISSWTFDMDDLRSQASLGTECEDSTLCKDSDISFYDLDSLQDQAPEGPHLLRDFSTKYDADIENDMTTKDKSAVSSPDQPASLVRNASMRGMPINGSFRKDNSTESFDLECQEKHLDIVPTSSSPERKFSFSSCSSNGLLLSKESSKQQTSIHNLDKCNGGHLHVSDETSSEAAPKTHKSAEDHDDRSKPPLIRGRFRVIPGHVDSKAQPPGLQKCHSMQTISRLPSLSIPSSAEVASTIIGGSFYMQLYSILQTNMLQRDQILNAMKQVSGCAMASPGVPSMASPCIPSTSRSTSPSGVPSVDRSMLEAAQEREKELLNEVLELQWRLLCTQDE

superfamily: SSF56112
IPR011009
93-399 Protein kinase-like (PK-like)
Protein kinase-like domain

GGGERRKYPIHVEDYELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFFKQARSTDFIARKLLEGLPGLGVRYQALKEKD

Gene3D: G3DSA:3.30.200.20
97-215 no description

RRKYPIHVEDYELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVL

HMMPfam: PF00069
IPR017442
107-368 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFF

ProfileScan: PS50011
IPR000719
107-368 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFF

HMMSmart: SM00219
IPR020635
107-368 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFF

HMMSmart: SM00220
IPR002290
107-368 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELYEEIGQGVSAIVYRALCKPLDEIVAVKVVDFERTNSDLNNIVREAQTMILIDHPNVVKAHCSFAKDQTLWVVMPYMAGGSCLHIMKSVHPTGFEEPIIATILREVLKGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFF

PatternScan: PS00107
IPR017441
113-136 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGVSAIVYRALCKPLDEIVAVK

Gene3D: G3DSA:1.10.510.10
216-374 no description

KGLEYLHHHGSIHRDVKAGNILVDSRGGIKLGDFGVSACLFDSGDRQRARNTFVGTPCWMAPEVMEQLHGYDFRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFTRNFKQMVAMCLVKDPSKRPSAKKLLKQPFFKQARST

Seg: seg
546-566 seg

SSSPERKFSFSSCSSNGLLLS

Seg: seg
646-657 seg

ISRLPSLSIPSS

Coil: coil
732-753 coiled-coil

LEAAQEREKELLNEVLELQWRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox