PRGDB00064246 (Zm.64407)

From PRG Wiki
Jump to: navigation, search
Zm.64407
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 47962017 (CN844726)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

EST2676 Zea mays embryo sac cDNA library Zea mays cDNA clone ES6372 5' similar to PDR-like ABC Transporter, mRNA sequence

DNA Sequence

GGAATAGAAGGAGTAAAGAAAATCAAGGATGGTTACAACCCTGCAACATGGATGTTGGAAGTGACCACCTTAGCTCAAGAAGATATCCTTGGGATCAACTTTGCTGAAGTATACAGAAACTCTGACCTGTACCGGAGGAATAAAGCTTTGATTAGTGAACTAAGCACACCACCACCAGGGTCCAATGACTTGTACTTCCCAACCCAGTACTCACAGTCCTTCCTCACACAATGCATGGCTTGCCTGTGGAAGCAGCACAAGTCTTACTGGAGAAATCCATCATATACCGCAACTAGGATCTTCTTCACAACAGTTATTGCTCTCATCTTCGGAACTATCTTCTTAAACTTGGGAAAGAAAATTGGCACTCGGCAGGACCTTTTCAATTCTTTGGGATCCATGTATGCAGCAGTTCTTTTCATTGGAATTCAGAATGGTCAAACTGTGCAGCCAATTGTGGATGTCGAGCGAACAGTTTTCTACCGAGAAAAGGCAGCTGGGATGTACTCTGCTCTACCCTATGCTTTTGCACAGGTTCTTATTGAGATCCCACACATCTTCCTTCAGACAGCTGTGTATGGTCTCATTGTCTACAGCCTGATTGGCTTTGATTGGACAGTTGCAAAGTTCTTCTGGTATATGTTCTTCATGGTTCTTCACCTTCATGTACTTCACATTTTATGGAATGATGGCAGTCGCCATGACACCAA


Protein sequences

Name Description Sequence
Zm.64407 translated coding region predicted by ESTScan from UniGene Zm.64407

GIEGVKKIKDGYNPATWMLEVTTLAQEDILGINFAEVYRNSDLYRRNKALISELSTPPPGSNDLYFPTQYSQSFLTQCMACLWKQHKSYWRNPSYTATRIFFTTVIALIFGTIFLNLGKKIGTRQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTAVYGLIVYSLIGFDWTVAKFFWYMFFMVLHLHVLHILWNDGSRHDTX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
7-221 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

KIKDGYNPATWMLEVTTLAQEDILGINFAEVYRNSDLYRRNKALISELSTPPPGSNDLYFPTQYSQSFLTQCMACLWKQHKSYWRNPSYTATRIFFTTVIALIFGTIFLNLGKKIGTRQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTAVYGLIVYSLIGFDWTVAKFFWYMFFMVLHL

HMMPanther: PTHR19241:SF10
7-221 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

KIKDGYNPATWMLEVTTLAQEDILGINFAEVYRNSDLYRRNKALISELSTPPPGSNDLYFPTQYSQSFLTQCMACLWKQHKSYWRNPSYTATRIFFTTVIALIFGTIFLNLGKKIGTRQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTAVYGLIVYSLIGFDWTVAKFFWYMFFMVLHL

HMMPfam: PF01061
IPR013525
76-220 ABC2_membrane
ABC-2 type transporter

TQCMACLWKQHKSYWRNPSYTATRIFFTTVIALIFGTIFLNLGKKIGTRQDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTAVYGLIVYSLIGFDWTVAKFFWYMFFMVLH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox